Property Summary

NCBI Gene PubMed Count 19
Grant Count 4
R01 Count 3
Funding $367,154.42
PubMed Score 23.99
PubTator Score 6.45

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
ependymoma -1.200 0.017
psoriasis -2.000 0.000
atypical teratoid / rhabdoid tumor -1.100 0.000
glioblastoma -1.300 0.000
medulloblastoma, large-cell -1.200 0.003
tuberculosis and treatment for 6 months 1.100 0.002
aldosterone-producing adenoma -1.053 0.017
ovarian cancer -1.700 0.000
Gaucher disease type 1 -1.200 0.012

 GO Function (1)

Gene RIF (2)

PMID Text
19420964 Observational study of gene-disease association. (HuGE Navigator)
18976975 Knockdown of cell division cycle 40 homolog (CDC40) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells

AA Sequence

MSAAIAALAASYGSGSGSESDSDSESSRCPLPAADSLMHLTKSPSSKPSLAVAVDSAPEVAVKEDLETGV      1 - 70
HLDPAVKEVQYNPTYETMFAPEFGPENPFRTQQMAAPRNMLSGYAEPAHINDFMFEQQRRTFATYGYALD     71 - 140
PSLDNHQVSAKYIGSVEEAEKNQGLTVFETGQKKTEKRKKFKENDASNIDGFLGPWAKYVDEKDVAKPSE    141 - 210
EEQKELDEITAKRQKKGKQEEEKPGEEKTILHVKEMYDYQGRSYLHIPQDVGVNLRSTMPPEKCYLPKKQ    211 - 280
IHVWSGHTKGVSAVRLFPLSGHLLLSCSMDCKIKLWEVYGERRCLRTFIGHSKAVRDICFNTAGTQFLSA    281 - 350
AYDRYLKLWDTETGQCISRFTNRKVPYCVKFNPDEDKQNLFVAGMSDKKIVQWDIRSGEIVQEYDRHLGA    351 - 420
VNTIVFVDENRRFVSTSDDKSLRVWEWDIPVDFKYIAEPSMHSMPAVTLSPNGKWLACQSMDNQILIFGA    421 - 490
QNRFRLNKKKIFKGHMVAGYACQVDFSPDMSYVISGDGNGKLNIWDWKTTKLYSRFKAHDKVCIGAVWHP    491 - 560
HETSKVITCGWDGLIKLWD                                                       561 - 579
//

Text Mined References (25)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22365833 2012 Dynamic protein-protein interaction wiring of the human spliceosome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19420964 2009 Somatic mutations of the CDC4 (FBXW7) gene in hereditary colorectal tumors.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
More...