Property Summary

NCBI Gene PubMed Count 20
PubMed Score 24.34
PubTator Score 6.45

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (9)

Disease log2 FC p
aldosterone-producing adenoma -1.053 1.7e-02
atypical teratoid / rhabdoid tumor -1.100 2.9e-05
ependymoma -1.200 1.7e-02
Gaucher disease type 1 -1.200 1.2e-02
glioblastoma -1.300 1.9e-04
medulloblastoma, large-cell -1.200 3.3e-03
ovarian cancer -1.700 4.1e-11
psoriasis -2.000 3.7e-05
tuberculosis and treatment for 6 months 1.100 2.0e-03

 GO Function (1)

Gene RIF (3)

AA Sequence

MSAAIAALAASYGSGSGSESDSDSESSRCPLPAADSLMHLTKSPSSKPSLAVAVDSAPEVAVKEDLETGV      1 - 70
HLDPAVKEVQYNPTYETMFAPEFGPENPFRTQQMAAPRNMLSGYAEPAHINDFMFEQQRRTFATYGYALD     71 - 140
PSLDNHQVSAKYIGSVEEAEKNQGLTVFETGQKKTEKRKKFKENDASNIDGFLGPWAKYVDEKDVAKPSE    141 - 210
EEQKELDEITAKRQKKGKQEEEKPGEEKTILHVKEMYDYQGRSYLHIPQDVGVNLRSTMPPEKCYLPKKQ    211 - 280
IHVWSGHTKGVSAVRLFPLSGHLLLSCSMDCKIKLWEVYGERRCLRTFIGHSKAVRDICFNTAGTQFLSA    281 - 350
AYDRYLKLWDTETGQCISRFTNRKVPYCVKFNPDEDKQNLFVAGMSDKKIVQWDIRSGEIVQEYDRHLGA    351 - 420
VNTIVFVDENRRFVSTSDDKSLRVWEWDIPVDFKYIAEPSMHSMPAVTLSPNGKWLACQSMDNQILIFGA    421 - 490
QNRFRLNKKKIFKGHMVAGYACQVDFSPDMSYVISGDGNGKLNIWDWKTTKLYSRFKAHDKVCIGAVWHP    491 - 560
HETSKVITCGWDGLIKLWD                                                       561 - 579
//

Text Mined References (26)

PMID Year Title