Property Summary

NCBI Gene PubMed Count 31
PubMed Score 28.69
PubTator Score 11.43

Knowledge Summary


No data available


  Disease Sources (1)

Disease Target Count P-value
malignant mesothelioma 3163 8.25114005099921E-7
glioblastoma 5572 4.32491258308728E-5
psoriasis 6685 7.13372160979355E-5
pediatric high grade glioma 2712 8.98208871385931E-5
atypical teratoid / rhabdoid tumor 4369 1.07996115544147E-4
group 3 medulloblastoma 2254 4.77821168801971E-4
COPD 116 0.0030472447600609
active Crohn's disease 918 0.00586327908209027
inflammatory breast cancer 404 0.00844064597505292
oligodendroglioma 2849 0.0124028668661128
active ulcerative colitis 477 0.0217258595002615


  Differential Expression (11)

Disease log2 FC p
malignant mesothelioma -1.500 0.000
oligodendroglioma 1.100 0.012
psoriasis -1.400 0.000
atypical teratoid / rhabdoid tumor 1.700 0.000
glioblastoma 1.800 0.000
active Crohn's disease -1.338 0.006
active ulcerative colitis -1.271 0.022
pediatric high grade glioma 1.300 0.000
group 3 medulloblastoma -1.500 0.000
inflammatory breast cancer -1.300 0.008
COPD -1.400 0.003


Accession O60504 Q5BJE4 Q6NX54 Q96FY4 Q9UQE4
Symbols SCAM1



2CT3   2DLM   2NWM   2YUP  

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Platypus OMA EggNOG

 GWAS Trait (1)

Gene RIF (9)

25972535 Taken together, the findings suggest that vinexin beta modulates NS5A phosphorylation via its interaction with NS5A, thereby regulating hepatitis C virus replication, implicating vinexin beta in the viral life cycle.
25824575 Our findings revealed that Vinexin-beta acts as a novel modulator of ischaemic injury
20361963 Vinexin knockdown using siRNA delayed migration of both HaCaT human keratinocytes and A431 epidermoid carcinoma cells in scratch assay but did not affect cell proliferation.
19294487 Rhotekin forms a complex with vinexin and may play a role at focal adhesions.
17486060 Vinexin is enriched at the leading edge of migrating cells, lamellipodia and and focal adhesions in well-spread cells.
16923119 These results suggest that vinexin beta plays a role in maintaining the phosphorylation of EGFR on the plasma membrane through the regulation of c-Cbl.
15734736 phosphorylation of the AF-1 domain controls RARgamma-mediated transcription through triggering the dissociation of vinexin beta
15184391 vinexin is a novel substrate of ERK2 and may play roles in ERK-dependent cell regulation
12510380 regulates cytoskeletal organization and signal transduction--review

AA Sequence

LELREGDRVDVMQQCDDGWFVGVSRRTQKFGTFPGNYVAPV                                 631 - 671

Text Mined References (44)

PMID Year Title
25972535 2015 Vinexin ? Interacts with Hepatitis C Virus NS5A, Modulating Its Hyperphosphorylation To Regulate Viral Propagation.
25824575 2015 Vinexin-? deficiency protects against cerebral ischaemia/reperfusion injury by inhibiting neuronal apoptosis.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.