Property Summary

NCBI Gene PubMed Count 34
PubMed Score 35.14
PubTator Score 11.43

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
active Crohn's disease -1.338 5.9e-03
active ulcerative colitis -1.271 2.2e-02
atypical teratoid / rhabdoid tumor 1.700 1.1e-04
COPD -1.400 3.0e-03
glioblastoma 1.800 4.3e-05
group 3 medulloblastoma -1.500 4.8e-04
inflammatory breast cancer -1.300 8.4e-03
malignant mesothelioma -1.400 3.9e-06
oligodendroglioma 1.100 1.2e-02
pediatric high grade glioma 1.300 9.0e-05
psoriasis -1.400 7.1e-05

Gene RIF (11)

AA Sequence

MQGPPRSLRAGLSLDDFIPGHLQSHIGSSSRGTRVPVIRNGGSNTLNFQFHDPAPRTVCNGGYTPRRDAS      1 - 70
QHPDPAWYQTWPGPGSKPSASTKIPASQHTQNWSATWTKDSKRRDKRWVKYEGIGPVDESGMPIAPRSSV     71 - 140
DRPRDWYRRMFQQIHRKMPDLQLDWTFEEPPRDPRHLGAQQRPAHRPGPATSSSGRSWDHSEELPRSTFN    141 - 210
YRPGAFSTVLQPSNQVLRRREKVDNVWTEESWNQFLQELETGQRPKKPLVDDPGEKPSQPIEVLLERELA    211 - 280
ELSAELDKDLRAIETRLPSPKSSPAPRRAPEQRPPAGPASAWSSSYPHAPYLGSARSLSPHKMADGGSPF    281 - 350
LGRRDFVYPSSTRDPSASNGGGSPARREEKKRKAARLKFDFQAQSPKELTLQKGDIVYIHKEVDKNWLEG    351 - 420
EHHGRLGIFPANYVEVLPADEIPKPIKPPTYQVLEYGEAVAQYTFKGDLEVELSFRKGEHICLIRKVNEN    421 - 490
WYEGRITGTGRQGIFPASYVQVSREPRLRLCDDGPQLPTSPRLTAAARSARHPSSPSALRSPADPIDLGG    491 - 560
QTSPRRTGFSFPTQEPRPQTQNLGTPGPALSHSRGPSHPLDLGTSSPNTSQIHWTPYRAMYQYRPQNEDE    561 - 630
LELREGDRVDVMQQCDDGWFVGVSRRTQKFGTFPGNYVAPV                                 631 - 671
//

Text Mined References (47)

PMID Year Title