Property Summary

NCBI Gene PubMed Count 35
Grant Count 14
R01 Count 12
Funding $1,258,920
PubMed Score 67.54
PubTator Score 37.51

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
astrocytic glioma -1.100 0.023
ependymoma -1.300 0.032
atypical teratoid / rhabdoid tumor -1.500 0.000
glioblastoma -1.400 0.001
medulloblastoma -1.400 0.001
medulloblastoma, large-cell -1.700 0.000
primitive neuroectodermal tumor -1.300 0.000
non-small cell lung cancer -1.245 0.000
intraductal papillary-mucinous adenoma (... -1.200 0.000
intraductal papillary-mucinous carcinoma... -1.100 0.005
lung cancer -2.000 0.002
breast carcinoma 1.100 0.002
lung adenocarcinoma -1.100 0.000
adult high grade glioma -1.400 0.000
spina bifida -2.235 0.033
ovarian cancer -2.200 0.000
dermatomyositis 1.200 0.013

Gene RIF (19)

PMID Text
25959651 The stronger TNF-alpha responses in young males compared to females may be partly associated with male-specific down-regulation of ADCY7 and ADCY9.
25583994 The effects of dalcetrapib on atherosclerotic outcomes are determined by correlated polymorphisms in the ADCY9 gene.
24722286 The importance of miR-181a-mediated AC9 downregulation in acute promyelocytic leukemia, is reported.
24269684 Data indicate that adenylyl cyclase 9 (AC9) transcript is a direct target of miR-181b.
22778270 in heart, Yotiao brings together PKA, PP1, PDE4D3, AC9, and the I(Ks) channel to achieve localized temporal regulation of beta-adrenergic stimulation.
20522523 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20459687 Observational study of gene-disease association. (HuGE Navigator)
20175803 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19156168 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
14996950 blocking glycosylation of AC9 significantly attenuates Galpha(s) stimulation.
More...

AA Sequence

MASPPHQQLLHHHSTEVSCDSSGDSNSVRVKINPKQLSSNSHPKHCKYSISSSCSSSGDSGGVPRRVGGG      1 - 70
GRLRRQKKLPQLFERASSRWWDPKFDSVNLEEACLERCFPQTQRRFRYALFYIGFACLLWSIYFAVHMRS     71 - 140
RLIVMVAPALCFLLVCVGFFLFTFTKLYARHYAWTSLALTLLVFALTLAAQFQVLTPVSGRGDSSNLTAT    141 - 210
ARPTDTCLSQVGSFSMCIEVLFLLYTVMHLPLYLSLCLGVAYSVLFETFGYHFRDEACFPSPGAGALHWE    211 - 280
LLSRGLLHGCIHAIGVHLFVMSQVRSRSTFLKVGQSIMHGKDLEVEKALKERMIHSVMPRIIADDLMKQG    281 - 350
DEESENSVKRHATSSPKNRKKKSSIQKAPIAFRPFKMQQIEEVSILFADIVGFTKMSANKSAHALVGLLN    351 - 420
DLFGRFDRLCEETKCEKISTLGDCYYCVAGCPEPRADHAYCCIEMGLGMIKAIEQFCQEKKEMVNMRVGV    421 - 490
HTGTVLCGILGMRRFKFDVWSNDVNLANLMEQLGVAGKVHISEATAKYLDDRYEMEDGKVIERLGQSVVA    491 - 560
DQLKGLKTYLISGQRAKESRCSCAEALLSGFEVIDGSQVSSGPRGQGTASSGNVSDLAQTVKTFDNLKTC    561 - 630
PSCGITFAPKSEAGAEGGAPQNGCQDEHKNSTKASGGPNPKTQNGLLSPPQEEKLTNSQTSLCEILQEKG    631 - 700
RWAGVSLDQSALLPLRFKNIREKTDAHFVDVIKEDSLMKDYFFKPPINQFSLNFLDQELERSYRTSYQEE    701 - 770
VIKNSPVKTFASPTFSSLLDVFLSTTVFLTLSTTCFLKYEAATVPPPPAALAVFSAALLLEVLSLAVSIR    771 - 840
MVFFLEDVMACTKRLLEWIAGWLPRHCIGAILVSLPALAVYSHVTSEYETNIHFPVFTGSAALIAVVHYC    841 - 910
NFCQLSSWMRSSLATVVGAGPLLLLYVSLCPDSSVLTSPLDAVQNFSSERNPCNSSVPRDLRRPASLIGQ    911 - 980
EVVLVFFLLLLLVWFLNREFEVSYRLHYHGDVEADLHRTKIQSMRDQADWLLRNIIPYHVAEQLKVSQTY    981 - 1050
SKNHDSGGVIFASIVNFSEFYEENYEGGKECYRVLNELIGDFDELLSKPDYSSIEKIKTIGATYMAASGL   1051 - 1120
NTAQAQDGSHPQEHLQILFEFAKEMMRVVDDFNNNMLWFNFKLRVGFNHGPLTAGVIGTTKLLYDIWGDT   1121 - 1190
VNIASRMDTTGVECRIQVSEESYRVLSKMGYDFDYRGTVNVKGKGQMKTYLYPKCTDHRVIPQHQLSISP   1191 - 1260
DIRVQVDGSIGRSPTDEIANLVPSVQYVDKTSLGSDSSTQAKDAHLSPKRPWKEPVKAEERGRFGKAIEK   1261 - 1330
DDCDETGIEEANELTKLNVSKSV                                                  1331 - 1353
//

Text Mined References (40)

PMID Year Title
25959651 2015 Higher TNF? responses in young males compared to females are associated with attenuation of monocyte adenylyl cyclase expression.
25583994 2015 Pharmacogenomic determinants of the cardiovascular effects of dalcetrapib.
24861553 2014 Meta-analysis of genome-wide association studies in East Asian-ancestry populations identifies four new loci for body mass index.
24722286 2014 MicroRNA-181a-mediated downregulation of AC9 protein decreases intracellular cAMP level and inhibits ATRA-induced APL cell differentiation.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24269684 2014 miR-181b promotes cell proliferation and reduces apoptosis by repressing the expression of adenylyl cyclase 9 (AC9) in cervical cancer cells.
23563607 2013 Genome-wide meta-analysis identifies 11 new loci for anthropometric traits and provides insights into genetic architecture.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22778270 2012 The A-kinase anchoring protein Yotiao facilitates complex formation between adenylyl cyclase type 9 and the IKs potassium channel in heart.
20935630 2010 Association analyses of 249,796 individuals reveal 18 new loci associated with body mass index.
More...