Property Summary

NCBI Gene PubMed Count 40
Grant Count 108
R01 Count 50
Funding $10,470,498.64
PubMed Score 2036.34
PubTator Score 2008.03

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession O60502 B7WPB9 D3DR79 E9PGF9 O75166 Q86WV0 Q8IV98 Q9BVA5 Q9HAR0 OGA
Symbols OGA
MEA5
NCOAT

Gene

PDB

2YDQ  

Gene RIF (26)

PMID Text
26527687 E2F1 negatively regulates both Ogt and Mgea5 expression in an Rb1 protein-dependent manner.
26269457 OGA overexpression in endothelial cells improves endothelial function and may have a beneficial effect on coronary vascular complications in diabetes.
25183011 This work identifies the first target of miR-539 in the heart and the first miRNA that regulates OGA.
25173736 Amino acid composition of splice variants, post-translational modifications, and stable associations with regulatory proteins influence subcellular distribution/substrate specificity of OGA and OGT (O-linked N-acetylglucosamine transferase). [REVIEW]
24705316 Report the presence of TGFBR3 and/or MGEA5 rearrangements in pleomorphic hyalinizing angiectatic tumors and the spectrum of related neoplasms.
24365779 Estrogen replacement therapy and plyometric training influence muscle OGT and OGA gene expression, which may be one of the mechanisms by which HRT and PT prevent aging-related loss of muscle mass.
22783592 Analysis of urinary content of MGEA5 and OGT may be useful for bladder cancer diagnostics.
22730328 O-linked beta-N-acetylglucosaminylation (O-GlcNAcylation) in primary and metastatic colorectal cancer clones and effect of N-acetyl-beta-D-glucosaminidase silencing on cell phenotype and transcriptome.
22311971 Data show that the interplay between O-GlcNAc and phosphorylation on proteins and indicate that these effects can be mediated by changes in hOGT and hOGA kinetic activity.
21717526 Chromosomal translocation t(1;10) is consistent with rearrangements of TGFBR3 and MGEA5 in both myxoinflammatory fibroblastic sarcoma and hemosiderotic fibrolipomatous tumor.
More...

AA Sequence

MVQKESQATLEERESELSSNPAASAGASLEPPAAPAPGEDNPAGAGGAAVAGAAGGARRFLCGVVEGFYG      1 - 70
RPWVMEQRKELFRRLQKWELNTYLYAPKDDYKHRMFWREMYSVEEAEQLMTLISAAREYEIEFIYAISPG     71 - 140
LDITFSNPKEVSTLKRKLDQVSQFGCRSFALLFDDIDHNMCAADKEVFSSFAHAQVSITNEIYQYLGEPE    141 - 210
TFLFCPTEYCGTFCYPNVSQSPYLRTVGEKLLPGIEVLWTGPKVVSKEIPVESIEEVSKIIKRAPVIWDN    211 - 280
IHANDYDQKRLFLGPYKGRSTELIPRLKGVLTNPNCEFEANYVAIHTLATWYKSNMNGVRKDVVMTDSED    281 - 350
STVSIQIKLENEGSDEDIETDVLYSPQMALKLALTEWLQEFGVPHQYSSRQVAHSGAKASVVDGTPLVAA    351 - 420
PSLNATTVVTTVYQEPIMSQGAALSGEPTTLTKEEEKKQPDEEPMDMVVEKQEETDHKNDNQILSEIVEA    421 - 490
KMAEELKPMDTDKESIAESKSPEMSMQEDCISDIAPMQTDEQTNKEQFVPGPNEKPLYTAEPVTLEDLQL    491 - 560
LADLFYLPYEHGPKGAQMLREFQWLRANSSVVSVNCKGKDSEKIEEWRSRAAKFEEMCGLVMGMFTRLSN    561 - 630
CANRTILYDMYSYVWDIKSIMSMVKSFVQWLGCRSHSSAQFLIGDQEPWAFRGGLAGEFQRLLPIDGAND    631 - 700
LFFQPPPLTPTSKVYTIRPYFPKDEASVYKICREMYDDGVGLPFQSQPDLIGDKLVGGLLSLSLDYCFVL    701 - 770
EDEDGICGYALGTVDVTPFIKKCKISWIPFMQEKYTKPNGDKELSEAEKIMLSFHEEQEVLPETFLANFP    771 - 840
SLIKMDIHKKVTDPSVAKSMMACLLSSLKANGSRGAFCEVRPDDKRILEFYSKLGCFEIAKMEGFPKDVV    841 - 910
ILGRSL                                                                    911 - 916
//

Text Mined References (53)

PMID Year Title
26527687 2015 E2F1 Transcription Factor Regulates O-linked N-acetylglucosamine (O-GlcNAc) Transferase and O-GlcNAcase Expression.
26363795 2016 The Role of MAPT in Neurodegenerative Diseases: Genetics, Mechanisms and Therapy.
26269457 2015 O-GlcNAcase overexpression reverses coronary endothelial cell dysfunction in type 1 diabetic mice.
25183011 2014 MicroRNA-539 is up-regulated in failing heart, and suppresses O-GlcNAcase expression.
25173736 2014 O-GlcNAc transferase and O-GlcNAcase: achieving target substrate specificity.
24705316 2014 TGFBR3 and MGEA5 rearrangements in pleomorphic hyalinizing angiectatic tumors and the spectrum of related neoplasms.
24365779 2013 OGT and OGA expression in postmenopausal skeletal muscle associates with hormone replacement therapy and muscle cross-sectional area.
24088714 2013 Structure of a bacterial putative acetyltransferase defines the fold of the human O-GlcNAcase C-terminal domain.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
More...