Property Summary

NCBI Gene PubMed Count 9
PubMed Score 14.12
PubTator Score 7.90

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
tuberculosis 2010 2.2e-09
psoriasis 6694 2.4e-04

Expression

  Differential Expression (2)

Disease log2 FC p
psoriasis 1.300 2.4e-04
tuberculosis 1.700 2.2e-09

Gene RIF (2)

AA Sequence

MSLEDPFFVVRGEVQKAVNTARGLYQRWCELLQESAAVGREELDWTTNELRNGLRSIEWDLEDLEETIGI      1 - 70
VEANPGKFKLPAGDLQERKVFVERMREAVQEMKDHMVSPTAVAFLERNNREILAGKPAAQKSPSDLLDAS     71 - 140
AVSATSRYIEEQQATQQLIMDEQDQQLEMVSGSIQVLKHMSGRVGEELDEQGIMLDAFAQEMDHTQSRMD    141 - 210
GVLRKLAKVSHMTSDRRQWCAIAVLVGVLLLVLILLFSL                                   211 - 249
//

Text Mined References (19)

PMID Year Title