Property Summary

NCBI Gene PubMed Count 9
PubMed Score 13.08
PubTator Score 7.90

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
tuberculosis 1563 2.18747131064352E-9
psoriasis 6685 2.39188512316882E-4
Disease Target Count Z-score Confidence
Inclusion body myositis 12 3.524 1.8

Expression

  Differential Expression (2)

Disease log2 FC p
psoriasis 1.300 0.000
tuberculosis 1.700 0.000

Synonym

Accession O60499 A6NC41 Q6IAP4 Q96AE8 Syn10
Symbols SYN10
hsyn10

Gene

PDB

4DND  

  Ortholog (6)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Xenopus OMA Inparanoid

Gene RIF (2)

PMID Text
26442221 Loss of syntaxin 10 leads to defects in normal chlamydial maturation including: variable inclusion size with fewer chlamydial organisms per inclusion, fewer infectious progeny, and delayed or halted reticulate body-elementary body differentiation.
16154903 May have a hitherto unrecognized function in the trans-Golgi network-endosome boundary.

AA Sequence

MSLEDPFFVVRGEVQKAVNTARGLYQRWCELLQESAAVGREELDWTTNELRNGLRSIEWDLEDLEETIGI      1 - 70
VEANPGKFKLPAGDLQERKVFVERMREAVQEMKDHMVSPTAVAFLERNNREILAGKPAAQKSPSDLLDAS     71 - 140
AVSATSRYIEEQQATQQLIMDEQDQQLEMVSGSIQVLKHMSGRVGEELDEQGIMLDAFAQEMDHTQSRMD    141 - 210
GVLRKLAKVSHMTSDRRQWCAIAVLVGVLLLVLILLFSL                                   211 - 249
//

Text Mined References (19)

PMID Year Title
26442221 2015 The trans-Golgi SNARE syntaxin 10 is required for optimal development of Chlamydia trachomatis.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
More...