Property Summary

NCBI Gene PubMed Count 30
PubMed Score 23.53
PubTator Score 19.58

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (5)

Disease log2 FC p
acute myeloid leukemia 1.100 6.7e-03
group 3 medulloblastoma -1.100 1.7e-02
medulloblastoma, large-cell -1.500 1.3e-05
ovarian cancer -2.000 1.9e-09
primitive neuroectodermal tumor -1.100 1.1e-03

 MGI Phenotype (1)

Protein-protein Interaction (7)

Gene RIF (12)

AA Sequence

MAETVADTRRLITKPQNLNDAYGPPSNFLEIDVSNPQTVGVGRGRFTTYEIRVKTNLPIFKLKESTVRRR      1 - 70
YSDFEWLRSELERESKVVVPPLPGKAFLRQLPFRGDDGIFDDNFIEERKQGLEQFINKVAGHPLAQNERC     71 - 140
LHMFLQDEIIDKSYTPSKIRHA                                                    141 - 162
//

Text Mined References (41)

PMID Year Title