Property Summary

NCBI Gene PubMed Count 28
Grant Count 9
R01 Count 4
Funding $426,831.65
PubMed Score 21.99
PubTator Score 19.58

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
medulloblastoma -1.300 0.000
medulloblastoma, large-cell -1.800 0.000
primitive neuroectodermal tumor -1.100 0.001
acute myeloid leukemia 1.100 0.007
ovarian cancer -2.000 0.000

Gene RIF (10)

PMID Text
26271979 Data show that over-expression of sorting nexin 3 (hSNX3) alters the morphology of colon cancer SW620 cells, but hardly affects cell migration.
23237080 SNX3 negatively regulates phagocytosis in DC possibly by modulating recruitment of essential PI3P lipid-binding proteins of the phagocytic pathways, such as EEA1, to phagosomal membranes.
22673115 This study found that four significant SNX3 SNPs in the discovery sample were replicated in a community-based sample of Israeli-Arabs
22159558 SNX3 and SNX5 play essential roles in the aspirin-mediated accumulation of endocytosed-TfnR at the early/sorting endosome
20634891 Observational study of gene-disease association. (HuGE Navigator)
20482551 SNX3 plays a significant role in regulating the maturation of Salmonella containing vacuoles.
18978678 Observational study of gene-disease association. (HuGE Navigator)
18767904 Data show that Hrs is essential for lysosomal targeting but not multivesicular body biogenesis and transport to late endosomes, while SNX3 is required for multivesicular body formation, but not for EGF receptor degradation.
17655765 we cannot exclude the possibility that deletions at SNX3 may underlie MMEP, given that sequencing is unable to distinguish between homozygosity across loci versus large deletions
12471201 Sorting nexin 3 (SNX3) is disrupted in a patient with a translocation t(6;13)(q21;q12) and microcephaly, microphthalmia, ectrodactyly, prognathism (MMEP) phenotype

AA Sequence

MAETVADTRRLITKPQNLNDAYGPPSNFLEIDVSNPQTVGVGRGRFTTYEIRVKTNLPIFKLKESTVRRR      1 - 70
YSDFEWLRSELERESKVVVPPLPGKAFLRQLPFRGDDGIFDDNFIEERKQGLEQFINKVAGHPLAQNERC     71 - 140
LHMFLQDEIIDKSYTPSKIRHA                                                    141 - 162
//

Text Mined References (38)

PMID Year Title
26271979 2015 [The morphological changes of SW620 cells induced by over-expression of human sorting nexin 3].
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
24866125 2014 Rapid mapping of interactions between Human SNX-BAR proteins measured in vitro by AlphaScreen and single-molecule spectroscopy.
24344282 2014 A mechanism for retromer endosomal coat complex assembly with cargo.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23237080 2013 SNX3 recruits to phagosomes and negatively regulates phagocytosis in dendritic cells.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
More...