Property Summary

NCBI Gene PubMed Count 45
PubMed Score 75.86
PubTator Score 61.38

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
astrocytoma -1.100 8.8e-16
glioblastoma multiforme -1.100 2.0e-18
atypical teratoid / rhabdoid tumor -2.000 1.0e-03
acute quadriplegic myopathy 1.549 1.4e-06
tuberculosis -1.400 1.9e-04
lung cancer -1.800 6.5e-04
colon cancer 1.100 1.8e-02
active Crohn's disease 2.222 7.7e-04
ulcerative colitis 3.200 8.2e-06
diabetes mellitus -1.400 1.6e-02
interstitial cystitis 1.700 4.4e-03
cystic fibrosis 1.200 1.1e-02
aldosterone-producing adenoma -1.387 2.3e-02
Breast cancer -1.400 6.1e-08
invasive ductal carcinoma -1.200 1.4e-03
ovarian cancer -1.200 1.3e-02

Protein-protein Interaction (1)

Gene RIF (30)

PMID Text
26636648 Suggest role for ACSL4 expression in development of castration-resistant prostate cancer.
26536660 we demonstrate that ACSL4 can be considered a novel activator of the mTOR pathway
26282205 In vitro analysis showed that a recombinant COX-2 enzyme more effectively metabolized 5(S)-HETE to 5-11-diHETE compared to COX-1 enzyme.
25645621 Report PPARdelta-mediated regulatory mechanism for ACSL4 expression in liver tissue and cultured hepatic cells.
25500141 Upregulation of ACSL4 is responsible for the increase in triacylglycerol species containing long polyunsaturated fatty acids during activation of hepatic stellate cells.
24576478 MiR-205 down-regulates ACSL4 through targeting its 3'UTR in hepatoma cells.
24201376 conclude that in our model system exogenous fatty acids are channeled preferentially towards phosphatidylinositol by ACSL4 overexpression
24155918 ACSL4 can serve as both a biomarker for, and mediator of, an aggressive breast cancer phenotype.
23874603 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies upregulation of acyl-CoA synthetase long-chain family member 4 (ACSL4) expression by HIV-1 Vpr in Vpr transduced macrophages
22808264 The functional interaction between Acyl-CoA synthetase 4, 5-lipooxygenase and cyclooxygenase-2 controls tumor growth.
21903867 the involvement of SHP2 activity in the regulation of the expression of the fatty acid-metabolizing enzyme ACSL4
21384559 A total of six novel and 11 known single nucleotide polymorphisms were identified. Further studies are warranted to analyze the candidate genes at Xq11.1-q21.33.
21242590 CSL4 modulates PGE release from human erial smooth muscle cells.
21085606 Data suggest that the development of combinatory therapies that profit from the ACSL4, lipooxygenase and COX-2 synergistic action may allow for lower medication doses and avoidance of side effects.
20452052 This study found no significant relationship between FACL4 and cognitive function.
20351714 Observational study of gene-disease association. (HuGE Navigator)
19617635 ACSL4 can substitute the functions of dAcsl(l(2)44DEa in organismal viability, lipid storage and the neural wiring in visual center.
19346733 The common SNP (C to T substitution) in the first intron of the FACL4 gene is associated with altered Fatty Acid composition of plasma phosphatidylcholines in patients with metabolic syndrome .
19346733 Observational study of gene-disease association. (HuGE Navigator)
18614287 No association between polymorphisms in the FACL4 (fatty acid-CoA ligase 4) gene and nonspecific mental retardation in Qin-Ba mountain region of China.
18614287 Observational study of gene-disease association. (HuGE Navigator)
18059177 FACL4 might play a role in the growth of hepatic cancer cells.
17934335 FACL4 affects HCC cell growth and suggest that modulation of FACL4 expression/activity is an approach for treatment of HCC.
16276108 Disruption of DMD and the absence of ACSL4 in a patient are responsible for neuromuscular disease and cognitive impairment.
15849811 FACL4 is involved in the hepatocellular carcinoma tumorigenesis and both cAMP and p38 MAPK pathways are associated with the regulation of FACL4
15108178 Observational study of gene-disease association. (HuGE Navigator)
12824887 Overexpression of Fatty acid-CoA ligase 4 is associated with human hepatocellular carcinoma
12525535 FACL4 is highly expressed in hippocampal and cerebellar neurons and may have a role in X linked mental retardation.
11889465 FACL4, encoding fatty acid-CoA ligase 4, is mutated in nonspecific X-linked mental retardation
11731423 Fatty acid CoA ligase 4 is up-regulated in colon adenocarcinoma.

AA Sequence

MKLKLNVLTIILLPVHLLITIYSALIFIPWYFLTNAKKKNAMAKRIKAKPTSDKPGSPYRSVTHFDSLAV      1 - 70
IDIPGADTLDKLFDHAVSKFGKKDSLGTREILSEENEMQPNGKVFKKLILGNYKWMNYLEVNRRVNNFGS     71 - 140
GLTALGLKPKNTIAIFCETRAEWMIAAQTCFKYNFPLVTLYATLGKEAVVHGLNESEASYLITSVELLES    141 - 210
KLKTALLDISCVKHIIYVDNKAINKAEYPEGFEIHSMQSVEELGSNPENLGIPPSRPTPSDMAIVMYTSG    211 - 280
STGRPKGVMMHHSNLIAGMTGQCERIPGLGPKDTYIGYLPLAHVLELTAEISCFTYGCRIGYSSPLTLSD    281 - 350
QSSKIKKGSKGDCTVLKPTLMAAVPEIMDRIYKNVMSKVQEMNYIQKTLFKIGYDYKLEQIKKGYDAPLC    351 - 420
NLLLFKKVKALLGGNVRMMLSGGAPLSPQTHRFMNVCFCCPIGQGYGLTESCGAGTVTEVTDYTTGRVGA    421 - 490
PLICCEIKLKDWQEGGYTINDKPNPRGEIVIGGQNISMGYFKNEEKTAEDYSVDENGQRWFCTGDIGEFH    491 - 560
PDGCLQIIDRKKDLVKLQAGEYVSLGKVEAALKNCPLIDNICAFAKSDQSYVISFVVPNQKRLTLLAQQK    561 - 630
GVEGTWVDICNNPAMEAEILKEIREAANAMKLERFEIPIKVRLSPEPWTPETGLVTDAFKLKRKELRNHY    631 - 700
LKDIERMYGGK                                                               701 - 711
//

Text Mined References (51)

PMID Year Title
26636648 2015 ACSL4 promotes prostate cancer growth, invasion and hormonal resistance.
26536660 2015 Acyl-CoA synthetase-4, a new regulator of mTOR and a potential therapeutic target for enhanced estrogen receptor function in receptor-positive and -negative breast cancer.
26282205 2015 Inhibition of long-chain acyl-CoA synthetase 4 facilitates production of 5, 11-dihydroxyeicosatetraenoic acid via the cyclooxygenase-2 pathway.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25645621 2015 PPAR? activation induces hepatic long-chain acyl-CoA synthetase 4 expression in vivo and in vitro.
25500141 2015 Role of long-chain acyl-CoA synthetase 4 in formation of polyunsaturated lipid species in hepatic stellate cells.
24576478 2014 Involvement of cholesterol in hepatitis B virus X protein-induced abnormal lipid metabolism of hepatoma cells via up-regulating miR-205-targeted ACSL4.
24201376 2014 Differentially localized acyl-CoA synthetase 4 isoenzymes mediate the metabolic channeling of fatty acids towards phosphatidylinositol.
24155918 2013 Long chain fatty Acyl-CoA synthetase 4 is a biomarker for and mediator of hormone resistance in human breast cancer.
23455425 2013 Autophagosomes form at ER-mitochondria contact sites.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22808264 2012 The functional interaction between Acyl-CoA synthetase 4, 5-lipooxygenase and cyclooxygenase-2 controls tumor growth: a novel therapeutic target.
21903867 2011 Tyrosine phosphatase SHP2 regulates the expression of acyl-CoA synthetase ACSL4.
21384559 2011 Fine mapping of Xq11.1-q21.33 and mutation screening of RPS6KA6, ZNF711, ACSL4, DLG3, and IL1RAPL2 for autism spectrum disorders (ASD).
21269460 2011 Initial characterization of the human central proteome.
21242590 2011 Long-chain acyl-CoA synthetase 4 modulates prostaglandin E? release from human arterial smooth muscle cells.
21085606 2010 Functional interaction between acyl-CoA synthetase 4, lipooxygenases and cyclooxygenase-2 in the aggressive phenotype of breast cancer cells.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20452052 2010 Genetic variations of FACL4 have no obvious influence on cognitive ability in young Chinese children.
20351714 2011 Poor replication of candidate genes for major depressive disorder using genome-wide association data.
19946888 2010 Defining the membrane proteome of NK cells.
19617635 2009 Analyses of mental dysfunction-related ACSl4 in Drosophila reveal its requirement for Dpp/BMP production and visual wiring in the brain.
19346733 2009 Fatty acid CoA ligase-4 gene polymorphism influences fatty acid metabolism in metabolic syndrome, but not in depression.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18614287 2008 No association between polymorphisms in the FACL4 (fatty acid-CoA ligase 4) gene and nonspecific mental retardation in Qin-Ba mountain region of China.
18059177 2008 The effect of fatty acid-CoA ligase 4 on the growth of hepatic cancer cells.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17934335 2007 Regulation of cell growth by fatty acid-CoA ligase 4 in human hepatocellular carcinoma cells.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16276108 2006 Disruption of DMD and deletion of ACSL4 causing developmental delay, hypotonia, and multiple congenital anomalies.
15849811 2005 Involvement of fatty acid-CoA ligase 4 in hepatocellular carcinoma growth: roles of cyclic AMP and p38 mitogen-activated protein kinase.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15292367 2004 Revised nomenclature for the mammalian long-chain acyl-CoA synthetase gene family.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
15108178 2004 Association of a long-chain fatty acid-CoA ligase 4 gene polymorphism with depression and with enhanced niacin-induced dermal erythema.
14741744 2004 Identification of major proteins in the lipid droplet-enriched fraction isolated from the human hepatocyte cell line HuH7.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12949969 2003 Localization of a non-syndromic X-linked mental retardation gene (MRX80) to Xq22-q24.
12824887 2003 Fatty acid-CoA ligase 4 is overexpressed in human hepatocellular carcinoma.
12525535 2003 A third MRX family (MRX68) is the result of mutation in the long chain fatty acid-CoA ligase 4 (FACL4) gene: proposal of a rapid enzymatic assay for screening mentally retarded patients.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11889465 2002 FACL4, encoding fatty acid-CoA ligase 4, is mutated in nonspecific X-linked mental retardation.
10874125 2000 In vitro metabolism of acitretin by human liver microsomes: evidence of an acitretinoyl-coenzyme A thioester conjugate in the transesterification to etretinate.
10669417 2000 Roles of PLC-beta2 and -beta3 and PI3Kgamma in chemoattractant-mediated signal transduction.
9598718 1998 Alport syndrome, mental retardation, midface hypoplasia, and elliptocytosis: a new X linked contiguous gene deletion syndrome?
9598324 1998 Cloning, expression, and chromosomal localization of human long-chain fatty acid-CoA ligase 4 (FACL4).
9480748 1998 FACL4, a new gene encoding long-chain acyl-CoA synthetase 4, is deleted in a family with Alport syndrome, elliptocytosis, and mental retardation.
8944226 1996 Biosynthesis of triacylglycerols.
1567471 1992 Inhibition kinetics of hepatic microsomal long chain fatty acid-CoA ligase by 2-arylpropionic acid non-steroidal anti-inflammatory drugs.