Property Summary

NCBI Gene PubMed Count 45
Grant Count 22
R01 Count 10
Funding $1,830,192.46
PubMed Score 75.86
PubTator Score 61.38

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
astrocytoma -1.100 0.000
glioblastoma multiforme -1.100 0.000
atypical teratoid / rhabdoid tumor -2.000 0.001
acute quadriplegic myopathy 1.549 0.000
tuberculosis -1.400 0.000
lung cancer -1.800 0.001
colon cancer 1.100 0.018
active Crohn's disease 2.222 0.001
ulcerative colitis 3.200 0.000
diabetes mellitus -1.400 0.016
interstitial cystitis 1.700 0.004
cystic fibrosis 1.200 0.011
aldosterone-producing adenoma -1.387 0.023
Breast cancer -1.400 0.000
invasive ductal carcinoma -1.200 0.001
ovarian cancer -1.200 0.013

Gene RIF (30)

PMID Text
26636648 Suggest role for ACSL4 expression in development of castration-resistant prostate cancer.
26536660 we demonstrate that ACSL4 can be considered a novel activator of the mTOR pathway
26282205 In vitro analysis showed that a recombinant COX-2 enzyme more effectively metabolized 5(S)-HETE to 5-11-diHETE compared to COX-1 enzyme.
25645621 Report PPARdelta-mediated regulatory mechanism for ACSL4 expression in liver tissue and cultured hepatic cells.
25500141 Upregulation of ACSL4 is responsible for the increase in triacylglycerol species containing long polyunsaturated fatty acids during activation of hepatic stellate cells.
24576478 MiR-205 down-regulates ACSL4 through targeting its 3'UTR in hepatoma cells.
24201376 conclude that in our model system exogenous fatty acids are channeled preferentially towards phosphatidylinositol by ACSL4 overexpression
24155918 ACSL4 can serve as both a biomarker for, and mediator of, an aggressive breast cancer phenotype.
23874603 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies upregulation of acyl-CoA synthetase long-chain family member 4 (ACSL4) expression by HIV-1 Vpr in Vpr transduced macrophages
22808264 The functional interaction between Acyl-CoA synthetase 4, 5-lipooxygenase and cyclooxygenase-2 controls tumor growth.
More...

AA Sequence

MKLKLNVLTIILLPVHLLITIYSALIFIPWYFLTNAKKKNAMAKRIKAKPTSDKPGSPYRSVTHFDSLAV      1 - 70
IDIPGADTLDKLFDHAVSKFGKKDSLGTREILSEENEMQPNGKVFKKLILGNYKWMNYLEVNRRVNNFGS     71 - 140
GLTALGLKPKNTIAIFCETRAEWMIAAQTCFKYNFPLVTLYATLGKEAVVHGLNESEASYLITSVELLES    141 - 210
KLKTALLDISCVKHIIYVDNKAINKAEYPEGFEIHSMQSVEELGSNPENLGIPPSRPTPSDMAIVMYTSG    211 - 280
STGRPKGVMMHHSNLIAGMTGQCERIPGLGPKDTYIGYLPLAHVLELTAEISCFTYGCRIGYSSPLTLSD    281 - 350
QSSKIKKGSKGDCTVLKPTLMAAVPEIMDRIYKNVMSKVQEMNYIQKTLFKIGYDYKLEQIKKGYDAPLC    351 - 420
NLLLFKKVKALLGGNVRMMLSGGAPLSPQTHRFMNVCFCCPIGQGYGLTESCGAGTVTEVTDYTTGRVGA    421 - 490
PLICCEIKLKDWQEGGYTINDKPNPRGEIVIGGQNISMGYFKNEEKTAEDYSVDENGQRWFCTGDIGEFH    491 - 560
PDGCLQIIDRKKDLVKLQAGEYVSLGKVEAALKNCPLIDNICAFAKSDQSYVISFVVPNQKRLTLLAQQK    561 - 630
GVEGTWVDICNNPAMEAEILKEIREAANAMKLERFEIPIKVRLSPEPWTPETGLVTDAFKLKRKELRNHY    631 - 700
LKDIERMYGGK                                                               701 - 711
//

Text Mined References (51)

PMID Year Title
26636648 2015 ACSL4 promotes prostate cancer growth, invasion and hormonal resistance.
26536660 2015 Acyl-CoA synthetase-4, a new regulator of mTOR and a potential therapeutic target for enhanced estrogen receptor function in receptor-positive and -negative breast cancer.
26282205 2015 Inhibition of long-chain acyl-CoA synthetase 4 facilitates production of 5, 11-dihydroxyeicosatetraenoic acid via the cyclooxygenase-2 pathway.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25645621 2015 PPAR? activation induces hepatic long-chain acyl-CoA synthetase 4 expression in vivo and in vitro.
25500141 2015 Role of long-chain acyl-CoA synthetase 4 in formation of polyunsaturated lipid species in hepatic stellate cells.
24576478 2014 Involvement of cholesterol in hepatitis B virus X protein-induced abnormal lipid metabolism of hepatoma cells via up-regulating miR-205-targeted ACSL4.
24201376 2014 Differentially localized acyl-CoA synthetase 4 isoenzymes mediate the metabolic channeling of fatty acids towards phosphatidylinositol.
24155918 2013 Long chain fatty Acyl-CoA synthetase 4 is a biomarker for and mediator of hormone resistance in human breast cancer.
23455425 2013 Autophagosomes form at ER-mitochondria contact sites.
More...