Property Summary

NCBI Gene PubMed Count 20
Grant Count 11
R01 Count 10
Funding $613,005.35
PubMed Score 19.14
PubTator Score 15.97

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
Chronic Lymphocytic Leukemia -1.939 0.000
malignant mesothelioma 1.200 0.001
psoriasis -2.600 0.000
osteosarcoma 1.905 0.009
medulloblastoma 2.100 0.001
atypical teratoid / rhabdoid tumor 2.200 0.000
glioblastoma 1.700 0.008
medulloblastoma, large-cell -2.700 0.001
adrenocortical carcinoma 1.704 0.000
tuberculosis 1.500 0.000
primary pancreatic ductal adenocarcinoma 1.243 0.002
lung cancer -3.000 0.000
active Crohn's disease 1.414 0.013
sarcoidosis 1.500 0.020
diabetes mellitus -1.200 0.003
interstitial cystitis 1.900 0.001
primary Sjogren syndrome 2.200 0.000
invasive ductal carcinoma 1.499 0.004
COPD 1.200 0.042
gastric carcinoma 2.200 0.016
ulcerative colitis 2.300 0.000
ovarian cancer -1.900 0.000
pancreatic cancer 1.100 0.003
head and neck cancer -1.200 0.003

Gene RIF (6)

PMID Text
23160370 loss of Plexin C1 in melanoma may promote early steps in melanoma progression through suppression of migration and proliferation
20727575 Study reports the structures of Sema7A and A39R complexed with the Semaphorin-binding module of PlexinC1; both structures show two PlexinC1 molecules symmetrically bridged by Semaphorin dimers.
19318806 significant loss of Plexin C1 in metastatic melanoma compared with primary melanoma, suggesting the possibility that the Plexin C1 receptor is a tumor suppressor protein for melanoma
18987670 Plexin C1, a receptor for semaphorin 7a, inactivates cofilin and is a potential tumor suppressor for melanoma progression.
18628988 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17671519 GTP-bound form of Rab7 promotes melanogenesis through the regulation of gp100 maturation in melanoma cells.

AA Sequence

MEVSRRKAPPRPPRPAAPLPLLAYLLALAAPGRGADEPVWRSEQAIGAIAASQEDGVFVASGSCLDQLDY      1 - 70
SLEHSLSRLYRDQAGNCTEPVSLAPPARPRPGSSFSKLLLPYREGAAGLGGLLLTGWTFDRGACEVRPLG     71 - 140
NLSRNSLRNGTEVVSCHPQGSTAGVVYRAGRNNRWYLAVAATYVLPEPETASRCNPAASDHDTAIALKDT    141 - 210
EGRSLATQELGRLKLCEGAGSLHFVDAFLWNGSIYFPYYPYNYTSGAATGWPSMARIAQSTEVLFQGQAS    211 - 280
LDCGHGHPDGRRLLLSSSLVEALDVWAGVFSAAAGEGQERRSPTTTALCLFRMSEIQARAKRVSWDFKTA    281 - 350
ESHCKEGDQPERVQPIASSTLIHSDLTSVYGTVVMNRTVLFLGTGDGQLLKVILGENLTSNCPEVIYEIK    351 - 420
EETPVFYKLVPDPVKNIYIYLTAGKEVRRIRVANCNKHKSCSECLTATDPHCGWCHSLQRCTFQGDCVHS    421 - 490
ENLENWLDISSGAKKCPKIQIIRSSKEKTTVTMVGSFSPRHSKCMVKNVDSSRELCQNKSQPNRTCTCSI    491 - 560
PTRATYKDVSVVNVMFSFGSWNLSDRFNFTNCSSLKECPACVETGCAWCKSARRCIHPFTACDPSDYERN    561 - 630
QEQCPVAVEKTSGGGRPKENKGNRTNQALQVFYIKSIEPQKVSTLGKSNVIVTGANFTRASNITMILKGT    631 - 700
STCDKDVIQVSHVLNDTHMKFSLPSSRKEMKDVCIQFDGGNCSSVGSLSYIALPHCSLIFPATTWISGGQ    701 - 770
NITMMGRNFDVIDNLIISHELKGNINVSEYCVATYCGFLAPSLKSSKVRTNVTVKLRVQDTYLDCGTLQY    771 - 840
REDPRFTGYRVESEVDTELEVKIQKENDNFNISKKDIEITLFHGENGQLNCSFENITRNQDLTTILCKIK    841 - 910
GIKTASTIANSSKKVRVKLGNLELYVEQESVPSTWYFLIVLPVLLVIVIFAAVGVTRHKSKELSRKQSQQ    911 - 980
LELLESELRKEIRDGFAELQMDKLDVVDSFGTVPFLDYKHFALRTFFPESGGFTHIFTEDMHNRDANDKN    981 - 1050
ESLTALDALICNKSFLVTVIHTLEKQKNFSVKDRCLFASFLTIALQTKLVYLTSILEVLTRDLMEQCSNM   1051 - 1120
QPKLMLRRTESVVEKLLTNWMSVCLSGFLRETVGEPFYLLVTTLNQKINKGPVDVITCKALYTLNEDWLL   1121 - 1190
WQVPEFSTVALNVVFEKIPENESADVCRNISVNVLDCDTIGQAKEKIFQAFLSKNGSPYGLQLNEIGLEL   1191 - 1260
QMGTRQKELLDIDSSSVILEDGITKLNTIGHYEISNGSTIKVFKKIANFTSDVEYSDDHCHLILPDSEAF   1261 - 1330
QDVQGKRHRGKHKFKVKEMYLTKLLSTKVAIHSVLEKLFRSIWSLPNSRAPFAIKYFFDFLDAQAENKKI   1331 - 1400
TDPDVVHIWKTNSLPLRFWVNILKNPQFVFDIKKTPHIDGCLSVIAQAFMDAFSLTEQQLGKEAPTNKLL   1401 - 1470
YAKDIPTYKEEVKSYYKAIRDLPPLSSSEMEEFLTQESKKHENEFNEEVALTEIYKYIVKYFDEILNKLE   1471 - 1540
RERGLEEAQKQLLHVKVLFDEKKKCKWM                                             1541 - 1568
//

Text Mined References (20)

PMID Year Title
23518928 2013 TSPYL5 SNPs: association with plasma estradiol concentrations and aromatase expression.
23468962 2013 A genome-wide scan for breast cancer risk haplotypes among African American women.
23160370 2013 The neural guidance receptor Plexin C1 delays melanoma progression.
21610070 2011 Structural basis of Rnd1 binding to plexin Rho GTPase binding domains (RBDs).
20727575 2010 Structural basis of semaphorin-plexin recognition and viral mimicry from Sema7A and A39R complexes with PlexinC1.
19946888 2010 Defining the membrane proteome of NK cells.
19792857 2009 Mechanical tension alters semaphorin expression in the periodontium.
19462467 2009 Molecular profiling of the "plexinome" in melanoma and pancreatic cancer.
19318806 2009 The semaphorin 7A receptor Plexin C1 is lost during melanoma metastasis.
18987670 2009 Plexin C1, a receptor for semaphorin 7a, inactivates cofilin and is a potential tumor suppressor for melanoma progression.
More...