Property Summary

NCBI Gene PubMed Count 21
PubMed Score 19.98
PubTator Score 15.97

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
active Crohn's disease 1.414 1.3e-02
adrenocortical carcinoma 1.390 6.0e-03
atypical teratoid / rhabdoid tumor 1.800 4.9e-03
Chronic Lymphocytic Leukemia -1.939 5.0e-05
COPD 1.200 4.2e-02
diabetes mellitus -1.200 2.8e-03
gastric carcinoma 1.100 4.3e-02
glioblastoma 1.300 2.1e-02
group 4 medulloblastoma 1.500 1.3e-02
head and neck cancer -1.200 3.5e-03
interstitial cystitis 1.200 5.1e-03
invasive ductal carcinoma 1.005 3.2e-03
lung cancer -2.000 8.3e-04
malignant mesothelioma 1.200 5.1e-04
medulloblastoma, large-cell -2.700 1.3e-03
osteosarcoma 1.905 8.8e-03
ovarian cancer -1.900 1.9e-06
pancreatic cancer 1.100 3.4e-03
primary pancreatic ductal adenocarcinoma 1.243 2.2e-03
primary Sjogren syndrome 2.200 2.5e-04
psoriasis -2.600 2.3e-05
sarcoidosis 1.500 2.0e-02
tuberculosis 1.200 6.6e-06
ulcerative colitis 2.300 1.0e-04

Gene RIF (7)

AA Sequence

MEVSRRKAPPRPPRPAAPLPLLAYLLALAAPGRGADEPVWRSEQAIGAIAASQEDGVFVASGSCLDQLDY      1 - 70
SLEHSLSRLYRDQAGNCTEPVSLAPPARPRPGSSFSKLLLPYREGAAGLGGLLLTGWTFDRGACEVRPLG     71 - 140
NLSRNSLRNGTEVVSCHPQGSTAGVVYRAGRNNRWYLAVAATYVLPEPETASRCNPAASDHDTAIALKDT    141 - 210
EGRSLATQELGRLKLCEGAGSLHFVDAFLWNGSIYFPYYPYNYTSGAATGWPSMARIAQSTEVLFQGQAS    211 - 280
LDCGHGHPDGRRLLLSSSLVEALDVWAGVFSAAAGEGQERRSPTTTALCLFRMSEIQARAKRVSWDFKTA    281 - 350
ESHCKEGDQPERVQPIASSTLIHSDLTSVYGTVVMNRTVLFLGTGDGQLLKVILGENLTSNCPEVIYEIK    351 - 420
EETPVFYKLVPDPVKNIYIYLTAGKEVRRIRVANCNKHKSCSECLTATDPHCGWCHSLQRCTFQGDCVHS    421 - 490
ENLENWLDISSGAKKCPKIQIIRSSKEKTTVTMVGSFSPRHSKCMVKNVDSSRELCQNKSQPNRTCTCSI    491 - 560
PTRATYKDVSVVNVMFSFGSWNLSDRFNFTNCSSLKECPACVETGCAWCKSARRCIHPFTACDPSDYERN    561 - 630
QEQCPVAVEKTSGGGRPKENKGNRTNQALQVFYIKSIEPQKVSTLGKSNVIVTGANFTRASNITMILKGT    631 - 700
STCDKDVIQVSHVLNDTHMKFSLPSSRKEMKDVCIQFDGGNCSSVGSLSYIALPHCSLIFPATTWISGGQ    701 - 770
NITMMGRNFDVIDNLIISHELKGNINVSEYCVATYCGFLAPSLKSSKVRTNVTVKLRVQDTYLDCGTLQY    771 - 840
REDPRFTGYRVESEVDTELEVKIQKENDNFNISKKDIEITLFHGENGQLNCSFENITRNQDLTTILCKIK    841 - 910
GIKTASTIANSSKKVRVKLGNLELYVEQESVPSTWYFLIVLPVLLVIVIFAAVGVTRHKSKELSRKQSQQ    911 - 980
LELLESELRKEIRDGFAELQMDKLDVVDSFGTVPFLDYKHFALRTFFPESGGFTHIFTEDMHNRDANDKN    981 - 1050
ESLTALDALICNKSFLVTVIHTLEKQKNFSVKDRCLFASFLTIALQTKLVYLTSILEVLTRDLMEQCSNM   1051 - 1120
QPKLMLRRTESVVEKLLTNWMSVCLSGFLRETVGEPFYLLVTTLNQKINKGPVDVITCKALYTLNEDWLL   1121 - 1190
WQVPEFSTVALNVVFEKIPENESADVCRNISVNVLDCDTIGQAKEKIFQAFLSKNGSPYGLQLNEIGLEL   1191 - 1260
QMGTRQKELLDIDSSSVILEDGITKLNTIGHYEISNGSTIKVFKKIANFTSDVEYSDDHCHLILPDSEAF   1261 - 1330
QDVQGKRHRGKHKFKVKEMYLTKLLSTKVAIHSVLEKLFRSIWSLPNSRAPFAIKYFFDFLDAQAENKKI   1331 - 1400
TDPDVVHIWKTNSLPLRFWVNILKNPQFVFDIKKTPHIDGCLSVIAQAFMDAFSLTEQQLGKEAPTNKLL   1401 - 1470
YAKDIPTYKEEVKSYYKAIRDLPPLSSSEMEEFLTQESKKHENEFNEEVALTEIYKYIVKYFDEILNKLE   1471 - 1540
RERGLEEAQKQLLHVKVLFDEKKKCKWM                                             1541 - 1568
//

Text Mined References (21)

PMID Year Title