Property Summary

NCBI Gene PubMed Count 30
Grant Count 55
R01 Count 29
Funding $10,367,584.42
PubMed Score 1131.03
PubTator Score 61.43

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
posterior fossa group B ependymoma 1.800 0.000
medulloblastoma 2.900 0.002
subependymal giant cell astrocytoma -2.857 0.001
ovarian cancer 1.100 0.000

Gene RIF (20)

PMID Text
26498524 detected the expression level of miR-564 and ZIC3 protein in tissue specimens, and found a significant negative correlation between them. Patients with low levels of miR-564 showed a poorer overall survival
26294094 Targeted Resequencing of 29 Candidate Genes and Mouse Expression Studies Implicate ZIC3 and FOXF1 in Human VATER/VACTERL Association
24123890 ZIC3 sequencing from unrelated patients with heterotaxy and congenital heart disease identified variants in 5.2% of sporadic male cases some of which were novel. Functional analyses show aberrant cytoplasmic localization.
23872418 sumoylation targets human ZIC3 primarily on the consensus lysine residue K248, which is critical for the nuclear retention of ZIC3.
23427188 ZIC3 mutations are an important etiology in sporadic and familial heterotaxy.
22171628 Case Reports: situs inversus totalis and X-linked heterotaxy as a result of novel ZIC3 mutation.
21864452 Mutations in Zinc Finger Protein of the Cerebellum 3 were identified in 4 of the 47 patients (8.5%) with heterotaxy syndrome. Our results expand the mutation spectrum of monogenic heterotaxy syndrome with associated cardiac anomalies.
21858219 Data show that transcript, termed Zic3-B, encompasses exons 1, 2, and 4 whereas Zic3-A encompasses exons 1, 2, and 3.
21069353 Disruption of Gli3-Zic3 interaction in the critical period for ventral body wall formation may contribute to omphalocele phenotype in Cd chick model.
18716025 results indicate that ZIC3 is imported into the cell nucleus by the Karyopherin (Importin) system and that the impaired nuclear localization by the ZF1 mutation is not due to a direct influence on the nuclear localization signal
More...

AA Sequence

MTMLLDGGPQFPGLGVGSFGAPRHHEMPNREPAGMGLNPFGDSTHAAAAAAAAAAFKLSPAAAHDLSSGQ      1 - 70
SSAFTPQGSGYANALGHHHHHHHHHHHTSQVPSYGGAASAAFNSTREFLFRQRSSGLSEAASGGGQHGLF     71 - 140
AGSASSLHAPAGIPEPPSYLLFPGLHEQGAGHPSPTGHVDNNQVHLGLRGELFGRADPYRPVASPRTDPY    141 - 210
AAGAQFPNYSPMNMNMGVNVAAHHGPGAFFRYMRQPIKQELSCKWIDEAQLSRPKKSCDRTFSTMHELVT    211 - 280
HVTMEHVGGPEQNNHVCYWEECPREGKSFKAKYKLVNHIRVHTGEKPFPCPFPGCGKIFARSENLKIHKR    281 - 350
THTGEKPFKCEFEGCDRRFANSSDRKKHMHVHTSDKPYICKVCDKSYTHPSSLRKHMKVHESQGSDSSPA    351 - 420
ASSGYESSTPPAIASANSKDTTKTPSAVQTSTSHNPGLPPNFNEWYV                           421 - 467
//

Text Mined References (34)

PMID Year Title
26498524 2015 MiR-564 functions as a tumor suppressor in human lung cancer by targeting ZIC3.
26294094 2015 Targeted Resequencing of 29 Candidate Genes and Mouse Expression Studies Implicate ZIC3 and FOXF1 in Human VATER/VACTERL Association.
24123890 2014 Genetic and functional analyses of ZIC3 variants in congenital heart disease.
23872418 2013 Sumoylation regulates nuclear localization and function of zinc finger transcription factor ZIC3.
23427188 2013 The phenotypic spectrum of ZIC3 mutations includes isolated d-transposition of the great arteries and double outlet right ventricle.
22171628 Situs inversus totalis and a novel ZIC3 mutation in a family with X-linked heterotaxy.
21864452 2012 Mutations in ZIC3 and ACVR2B are a common cause of heterotaxy and associated cardiovascular anomalies.
21858219 2011 Identification of a novel ZIC3 isoform and mutation screening in patients with heterotaxy and congenital heart disease.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21069353 2011 Disruption of GLI3-ZIC3 interaction in the cadmium-induced omphalocele chick model.
More...