Property Summary

NCBI Gene PubMed Count 31
PubMed Score 1223.56
PubTator Score 61.43

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count P-value
ovarian cancer 8520 3.2e-08
subependymal giant cell astrocytoma 2287 5.3e-04
ependymoma 4679 1.4e-02
group 3 medulloblastoma 4104 4.2e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Right atrial isomerism 29 0.0 5.0
Disease Target Count Z-score Confidence
Visceral heterotaxy 14 3.425 1.7

Expression

  Differential Expression (4)

Disease log2 FC p
ependymoma 1.300 1.4e-02
group 3 medulloblastoma 2.800 4.2e-02
ovarian cancer 1.100 3.2e-08
subependymal giant cell astrocytoma -2.857 5.3e-04

Gene RIF (21)

AA Sequence

MTMLLDGGPQFPGLGVGSFGAPRHHEMPNREPAGMGLNPFGDSTHAAAAAAAAAAFKLSPAAAHDLSSGQ      1 - 70
SSAFTPQGSGYANALGHHHHHHHHHHHTSQVPSYGGAASAAFNSTREFLFRQRSSGLSEAASGGGQHGLF     71 - 140
AGSASSLHAPAGIPEPPSYLLFPGLHEQGAGHPSPTGHVDNNQVHLGLRGELFGRADPYRPVASPRTDPY    141 - 210
AAGAQFPNYSPMNMNMGVNVAAHHGPGAFFRYMRQPIKQELSCKWIDEAQLSRPKKSCDRTFSTMHELVT    211 - 280
HVTMEHVGGPEQNNHVCYWEECPREGKSFKAKYKLVNHIRVHTGEKPFPCPFPGCGKIFARSENLKIHKR    281 - 350
THTGEKPFKCEFEGCDRRFANSSDRKKHMHVHTSDKPYICKVCDKSYTHPSSLRKHMKVHESQGSDSSPA    351 - 420
ASSGYESSTPPAIASANSKDTTKTPSAVQTSTSHNPGLPPNFNEWYV                           421 - 467
//

Text Mined References (36)

PMID Year Title