Property Summary

NCBI Gene PubMed Count 42
Grant Count 125
R01 Count 61
Funding $14,656,264.1
PubMed Score 151.46
PubTator Score 69.16

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
medulloblastoma, large-cell 1.300 0.030

Synonym

Accession O60479 B3KQL6
Symbols AI4
TDO

Gene

PDB

4XRS  

Gene RIF (34)

PMID Text
26674964 ER-alpha regulates the osteoblast differentiation through modulation of Dlx3 expression and/or interaction with Dlx3.
25247779 rs2278163 SNP of DLX3 might be associated with dental caries susceptibility in Japanese children. T and C alleles of rs2278163 SNP may potentially be involved in caries susceptibility and caries protection respectively.
24924519 Results suggest that Dlx3 is a novel target of PKA, and that PKA mediates BMP signaling during osteoblast differentiation, at least in part, by phosphorylating Dlx3 and modulating its stability and function.
24321094 In conclusion, results of our study suggest that the NOTCH-signaling pathway, which is activated during the osteogenic differentiation of DFCs.
23831639 DLX3 orchestrates the expression of multiple regulators of trophoblast differentiation and that expression of these regulatory genes is abnormal in fetal growth restriction.
22113468 Increased DLX3 expression in idiopathic fetal growth restricion (FGR) may contribute to trophoblast dysfunction observed in FGR.
22107079 DLX3 stimulates osteogenic differentiation via BMP2 dependent pathway.
21802725 DLX3 acts upstream of syncytin, 3beta-hydroxysteroid dehydrogenase, and the human gonadotropin beta-subunit to play a regulatory role in villous cytotrophoblast differentiation.
21520071 In cells expressing equal amounts of mutant and wild-type DLX3, deltaNp63alpha protein level was efficiently regulated, implying that heterozygosity at the DLX3 locus protects tricho-dento-osseous patients from severe p63-associated skin defects.
21268066 SUMOylation of DLX3 by SUMO1 promotes its transcriptional activity.
More...

AA Sequence

MSGSFDRKLSSILTDISSSLSCHAGSKDSPTLPESSVTDLGYYSAPQHDYYSGQPYGQTVNPYTYHHQFN      1 - 70
LNGLAGTGAYSPKSEYTYGASYRQYGAYREQPLPAQDPVSVKEEPEAEVRMVNGKPKKVRKPRTIYSSYQ     71 - 140
LAALQRRFQKAQYLALPERAELAAQLGLTQTQVKIWFQNRRSKFKKLYKNGEVPLEHSPNNSDSMACNSP    141 - 210
PSPALWDTSSHSTPAPARSQLPPPLPYSASPSYLDDPTNSWYHAQNLSGPHLQQQPPQPATLHHASPGPP    211 - 280
PNPGAVY                                                                   281 - 287
//

Text Mined References (42)

PMID Year Title
26674964 2016 Estrogen Receptor ? Regulates Dlx3-Mediated Osteoblast Differentiation.
25247779 2015 Association of DLX3 gene polymorphism and dental caries susceptibility in Japanese children.
24924519 2014 Protein kinase a phosphorylates Dlx3 and regulates the function of Dlx3 during osteoblast differentiation.
24321094 2014 NOTCH1 signaling regulates the BMP2/DLX-3 directed osteogenic differentiation of dental follicle cells.
23831639 2013 Downstream targets of the homeobox gene DLX3 are differentially expressed in the placentae of pregnancies affected by human idiopathic fetal growth restriction.
22113468 2012 Homeobox gene Distal-less 3 is a regulator of villous cytotrophoblast differentiation and its expression is increased in human idiopathic foetal growth restriction.
22107079 2012 The transcription factor DLX3 regulates the osteogenic differentiation of human dental follicle precursor cells.
21802725 2011 Homeobox gene Distal-less 3 (DLX3) is a regulator of villous cytotrophoblast differentiation.
21520071 2011 A dominant mutation etiologic for human tricho-dento-osseous syndrome impairs the ability of DLX3 to downregulate ?Np63?.
21268066 2011 SUMOylation of DLX3 by SUMO1 promotes its transcriptional activity.
More...