Property Summary

NCBI Gene PubMed Count 29
PubMed Score 18.55
PubTator Score 21.49

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
adult high grade glioma -3.200 8.6e-08
astrocytoma -1.500 2.7e-10
Astrocytoma, Pilocytic -1.200 2.8e-03
atypical teratoid / rhabdoid tumor -2.800 2.1e-03
Breast cancer -1.100 1.3e-02
ependymoma -4.300 1.1e-18
glioblastoma -2.600 5.2e-05
group 3 medulloblastoma -1.700 4.8e-04
lung carcinoma 1.100 5.0e-04
medulloblastoma, large-cell -3.300 1.4e-05
oligodendroglioma -1.300 2.4e-07
primitive neuroectodermal tumor -3.100 4.2e-04
psoriasis 2.400 2.0e-42

Gene RIF (12)

AA Sequence

MNWRFVELLYFLFIWGRISVQPSHQEPAGTDQHVSKEFDWLISDRGPFHHSRSYLSFVERHRQGFTTRYK      1 - 70
IYREFARWKVRNTAIERRDLVRHPVPLMPEFQRSIRLLGRRPTTQQFIDTIIKKYGTHLLISATLGGEEA     71 - 140
LTMYMDKSRLDRKSGNATQSVEALHQLASSYFVDRDGTMRRLHEIQISTGAIKVTETRTGPLGCNSYDNL    141 - 210
DSVSSVLLQSTESKLHLQGLQIIFPQYLQEKFVQSALSYIMCNGEGEYLCQNSQCRCQCAEEFPQCNCPI    211 - 280
TDIQIMEYTLANMAKSWAEAYKDLENSDEFKSFMKRLPSNHFLTIGSIHQHWGNDWDLQNRYKLLQSATE    281 - 350
AQRQKIQRTARKLFGLSVRCRHNPNHQLPRERTIQQWLARVQSLLYCNENGFWGTFLESQRSCVCHGSTT    351 - 420
LCQRPIPCVIGGNNSCAMCSLANISLCGSCNKGYKLYRGRCEPQNVDSERSEQFISFETDLDFQDLELKY    421 - 490
LLQKMDSRLYVHTTFISNEIRLDTFFDPRWRKRMSLTLKSNKNRMDFIHMVIGMSMRICQMRNSSLDPMF    491 - 560
FVYVNPFSGSHSEGWNMPFGEFGYPRWEKIRLQNSQCYNWTLLLGNRWKTFFETVHIYLRSRTRLPTLLR    561 - 630
NETGQGPVDLSDPSKRQFYIKISDVQVFGYSLRFNADLLRSAVQQVNQSYTQGGQFYSSSSVMLLLLDIR    631 - 700
DRINRLAPPVAPGKPQLDLFSCMLKHRLKLTNSEIIRVNHALDLYNTEILKQSDQMTAKLC             701 - 761
//

Text Mined References (30)

PMID Year Title