Property Summary

NCBI Gene PubMed Count 29
Grant Count 12
R01 Count 11
Funding $1,033,772.42
PubMed Score 17.72
PubTator Score 21.49

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
astrocytoma -1.500 0.000
glioblastoma -3.200 0.001
oligodendroglioma -1.300 0.000
posterior fossa group A ependymoma -4.600 0.000
sonic hedgehog group medulloblastoma -2.700 0.000
atypical teratoid / rhabdoid tumor -2.800 0.002
medulloblastoma, large-cell -3.300 0.000
primitive neuroectodermal tumor -3.100 0.000
adult high grade glioma -3.200 0.000
pilocytic astrocytoma -1.200 0.002
Breast cancer -1.700 0.000
lung carcinoma 1.100 0.000
psoriasis 2.400 0.000

Gene RIF (12)

PMID Text
23398316 DBC1 modulates the stability and function of the nuclear receptor Rev-erb-alpha.
23349863 we found that the SIRT1 modulators AROS and DBC1 have an impact on hsp70 transcription, HSF1 acetylation status, and HSF1 recruitment to the hsp70 promoter
22465953 the stress-induced DBC1-SIRT1 interaction is important for cell fate determination following genotoxic stress.
21056897 Rxpression of DBC1 and SIRT1 is a significant prognostic indicator for breast carcinoma patients.
20429629 High DBC1 expression is associated with breast and lung cancer..
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19834503 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
19506219 Observational study of gene-disease association. (HuGE Navigator)
18264085 hypermethylation of the DBC1 promoter region is a frequent event during the development of lymphoproliferative malignancies
15746151 likely tumor suppressor for NSCLC;silencing through homozygous deletion or methylation of its promoter promotes progression
More...

AA Sequence

MNWRFVELLYFLFIWGRISVQPSHQEPAGTDQHVSKEFDWLISDRGPFHHSRSYLSFVERHRQGFTTRYK      1 - 70
IYREFARWKVRNTAIERRDLVRHPVPLMPEFQRSIRLLGRRPTTQQFIDTIIKKYGTHLLISATLGGEEA     71 - 140
LTMYMDKSRLDRKSGNATQSVEALHQLASSYFVDRDGTMRRLHEIQISTGAIKVTETRTGPLGCNSYDNL    141 - 210
DSVSSVLLQSTESKLHLQGLQIIFPQYLQEKFVQSALSYIMCNGEGEYLCQNSQCRCQCAEEFPQCNCPI    211 - 280
TDIQIMEYTLANMAKSWAEAYKDLENSDEFKSFMKRLPSNHFLTIGSIHQHWGNDWDLQNRYKLLQSATE    281 - 350
AQRQKIQRTARKLFGLSVRCRHNPNHQLPRERTIQQWLARVQSLLYCNENGFWGTFLESQRSCVCHGSTT    351 - 420
LCQRPIPCVIGGNNSCAMCSLANISLCGSCNKGYKLYRGRCEPQNVDSERSEQFISFETDLDFQDLELKY    421 - 490
LLQKMDSRLYVHTTFISNEIRLDTFFDPRWRKRMSLTLKSNKNRMDFIHMVIGMSMRICQMRNSSLDPMF    491 - 560
FVYVNPFSGSHSEGWNMPFGEFGYPRWEKIRLQNSQCYNWTLLLGNRWKTFFETVHIYLRSRTRLPTLLR    561 - 630
NETGQGPVDLSDPSKRQFYIKISDVQVFGYSLRFNADLLRSAVQQVNQSYTQGGQFYSSSSVMLLLLDIR    631 - 700
DRINRLAPPVAPGKPQLDLFSCMLKHRLKLTNSEIIRVNHALDLYNTEILKQSDQMTAKLC             701 - 761
//

Text Mined References (30)

PMID Year Title
23398316 2013 DBC1 (Deleted in Breast Cancer 1) modulates the stability and function of the nuclear receptor Rev-erb?.
23349863 2013 The SIRT1 modulators AROS and DBC1 regulate HSF1 activity and the heat shock response.
22465953 2012 Regulation of SIRT1 activity by genotoxic stress.
22446626 2012 DBIRD complex integrates alternative mRNA splicing with RNA polymerase II transcript elongation.
21056897 2011 Expression of DBC1 and SIRT1 is associated with poor prognosis for breast carcinoma.
20429629 2010 Deleted in breast cancer 1 (DBC1) is a dynamically regulated protein.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20074560 2010 Repression of estrogen receptor beta function by putative tumor suppressor DBC1.
20070850 2010 Genome-wide association study confirms SNPs in SNCA and the MAPT region as common risk factors for Parkinson disease.
19834503 2009 Replication of CD58 and CLEC16A as genome-wide significant risk genes for multiple sclerosis.
More...