Property Summary

NCBI Gene PubMed Count 13
PubMed Score 2.65
PubTator Score 37.01

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
adult high grade glioma -1.100 6.0e-03
atypical teratoid / rhabdoid tumor -1.400 1.8e-08
Breast cancer 2.600 2.4e-02
ependymoma -1.100 3.3e-02
glioblastoma -1.500 9.0e-07
intraductal papillary-mucinous neoplasm ... -1.200 1.3e-03
malignant mesothelioma -1.200 1.5e-06
medulloblastoma, large-cell -1.700 6.4e-06
oligodendroglioma -1.100 4.2e-02
osteosarcoma -1.219 7.0e-03
ovarian cancer 1.300 8.6e-04
pancreatic cancer -1.200 4.3e-03
pituitary cancer 1.200 9.7e-06
primary pancreatic ductal adenocarcinoma -1.207 2.8e-03

 GWAS Trait (1)

Gene RIF (19)

AA Sequence

MTTPALLPLSGRRIPPLNLGPPSFPHHRATLRLSEKFILLLILSAFITLCFGAFFFLPDSSKHKRFDLGL      1 - 70
EDVLIPHVDAGKGAKNPGVFLIHGPDEHRHREEEERLRNKIRADHEKALEEAKEKLRKSREEIRAEIQTE     71 - 140
KNKVVQEMKIKENKPLPPVPIPNLVGIRGGDPEDNDIREKREKIKEMMKHAWDNYRTYGWGHNELRPIAR    141 - 210
KGHSPNIFGSSQMGATIVDALDTLYIMGLHDEFLDGQRWIEDNLDFSVNSEVSVFEVNIRFIGGLLAAYY    211 - 280
LSGEEIFKIKAVQLAEKLLPAFNTPTGIPWAMVNLKSGVGRNWGWASAGSSILAEFGTLHMEFIHLSYLT    281 - 350
GDLTYYKKVMHIRKLLQKMDRPNGLYPNYLNPRTGRWGQYHTSVGGLGDSFYEYLLKAWLMSDKTDHEAR    351 - 420
KMYDDAIEAIEKHLIKKSRGGLTFIGEWKNGHLEKKMGHLACFAGGMFALGADGSRADKAGHYLELGAEI    421 - 490
ARTCHESYDRTALKLGPESFKFDGAVEAVAVRQAEKYYILRPEVIETYWYLWRFTHDPRYRQWGWEAALA    491 - 560
IEKYCRVNGGFSGVKDVYSSTPTHDDVQQSFFLAETLKYLYLLFSGDDLLPLDHWVFNTEAHPLPVLHLA    561 - 630
NTTLSGNPAVR                                                               631 - 641
//

Text Mined References (15)

PMID Year Title