Property Summary

NCBI Gene PubMed Count 30
Grant Count 122
R01 Count 85
Funding $21,846,860.02
PubMed Score 131.14
PubTator Score 54.47

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytic glioma 1.200 0.034
psoriasis 1.100 0.000
oligodendroglioma 1.100 0.000
posterior fossa group A ependymoma -1.300 0.000
atypical teratoid / rhabdoid tumor -2.000 0.000
group 4 medulloblastoma -2.100 0.000
medulloblastoma, large-cell -2.700 0.000
pilocytic astrocytoma 2.300 0.000
lung carcinoma 1.900 0.000
ovarian cancer 1.200 0.000
pituitary cancer -1.300 0.000

Synonym

Accession O60469 O60468
Symbols CHD2
CHD2-42
CHD2-52

Gene

Gene RIF (20)

PMID Text
25867994 The most significant was DSCAM, a neurological gene expressed widely in the developing brain and in the amygdala and hippocampus of the adult brain.
25653356 DSCAM physically interacts with tubulin folding cofactor D.
25408124 Our study did not repeatedly confirm the association of the rs2222973 or the rs11770843 SNP with adolescent idiopathic scoliosis in a Chinese Han population.
23671607 DSCAM as a Hirschsprung disease (HSCR) susceptibility locus, both in Down syndrome and HSCR isolated cases.
23479427 Down syndrome cell adhesion molecule interacts with PRKAG1 subunit and plays an important role in netrin-1 induced neurite outgrowth.
22744455 Overall, our study found a significant association of IL-17RC gene polymorphisms with AIS in a Chinese Han population, indicating IL-17RC gene may be as a susceptibility gene for AIS.
22685302 knockdown of DSCAM inhibits netrin-induced tyrosine phosphorylation of UNC5C and Fyn as well as the interaction of UNC5C with Fyn. The double knockdown of both receptors abolishes the induction of Fyn tyrosine phosphorylation by netrin-1
21645617 functionally conserved with Drosophila Dscam[TM1] isoforms
21360594 Dscam may be involved in the generation and development of intractable epilepsy.
21079520 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MWILALSLFQSFANVFSEDLHSSLYFVNASLQEVVFASTTGTLVPCPAAGIPPVTLRWYLATGEEIYDVP      1 - 70
GIRHVHPNGTLQIFPFPPSSFSTLIHDNTYYCTAENPSGKIRSQDVHIKAVLREPYTVRVEDQKTMRGNV     71 - 140
AVFKCIIPSSVEAYITVVSWEKDTVSLVSGSRFLITSTGALYIKDVQNEDGLYNYRCITRHRYTGETRQS    141 - 210
NSARLFVSDPANSAPSILDGFDHRKAMAGQRVELPCKALGHPEPDYRWLKDNMPLELSGRFQKTVTGLLI    211 - 280
ENIRPSDSGSYVCEVSNRYGTAKVIGRLYVKQPLKATISPRKVKSSVGSQVSLSCSVTGTEDQELSWYRN    281 - 350
GEILNPGKNVRITGINHENLIMDHMVKSDGGAYQCFVRKDKLSAQDYVQVVLEDGTPKIISAFSEKVVSP    351 - 420
AEPVSLMCNVKGTPLPTITWTLDDDPILKGGSHRISQMITSEGNVVSYLNISSSQVRDGGVYRCTANNSA    421 - 490
GVVLYQARINVRGPASIRPMKNITAIAGRDTYIHCRVIGYPYYSIKWYKNSNLLPFNHRQVAFENNGTLK    491 - 560
LSDVQKEVDEGEYTCNVLVQPQLSTSQSVHVTVKVPPFIQPFEFPRFSIGQRVFIPCVVVSGDLPITITW    561 - 630
QKDGRPIPGSLGVTIDNIDFTSSLRISNLSLMHNGNYTCIARNEAAAVEHQSQLIVRVPPKFVVQPRDQD    631 - 700
GIYGKAVILNCSAEGYPVPTIVWKFSKGAGVPQFQPIALNGRIQVLSNGSLLIKHVVEEDSGYYLCKVSN    701 - 770
DVGADVSKSMYLTVKIPAMITSYPNTTLATQGQKKEMSCTAHGEKPIIVRWEKEDRIINPEMARYLVSTK    771 - 840
EVGEEVISTLQILPTVREDSGFFSCHAINSYGEDRGIIQLTVQEPPDPPEIEIKDVKARTITLRWTMGFD    841 - 910
GNSPITGYDIECKNKSDSWDSAQRTKDVSPQLNSATIIDIHPSSTYSIRMYAKNRIGKSEPSNELTITAD    911 - 980
EAAPDGPPQEVHLEPISSQSIRVTWKAPKKHLQNGIIRGYQIGYREYSTGGNFQFNIISVDTSGDSEVYT    981 - 1050
LDNLNKFTQYGLVVQACNRAGTGPSSQEIITTTLEDVPSYPPENVQAIATSPESISISWSTLSKEALNGI   1051 - 1120
LQGFRVIYWANLMDGELGEIKNITTTQPSLELDGLEKYTNYSIQVLAFTRAGDGVRSEQIFTRTKEDVPG   1121 - 1190
PPAGVKAAAASASMVFVSWLPPLKLNGIIRKYTVFCSHPYPTVISEFEASPDSFSYRIPNLSRNRQYSVW   1191 - 1260
VVAVTSAGRGNSSEIITVEPLAKAPARILTFSGTVTTPWMKDIVLPCKAVGDPSPAVKWMKDSNGTPSLV   1261 - 1330
TIDGRRSIFSNGSFIIRTVKAEDSGYYSCIANNNWGSDEIILNLQVQVPPDQPRLTVSKTTSSSITLSWL   1331 - 1400
PGDNGGSSIRGYILQYSEDNSEQWGSFPISPSERSYRLENLKCGTWYKFTLTAQNGVGPGRISEIIEAKT   1401 - 1470
LGKEPQFSKEQELFASINTTRVRLNLIGWNDGGCPITSFTLEYRPFGTTVWTTAQRTSLSKSYILYDLQE   1471 - 1540
ATWYELQMRVCNSAGCAEKQANFATLNYDGSTIPPLIKSVVQNEEGLTTNEGLKMLVTISCILVGVLLLF   1541 - 1610
VLLLVVRRRRREQRLKRLRDAKSLAEMLMSKNTRTSDTLSKQQQTLRMHIDIPRAQLLIEERDTMETIDD   1611 - 1680
RSTVLLTDADFGEAAKQKSLTVTHTVHYQSVSQATGPLVDVSDARPGTNPTTRRNAKAGPTARNRYASQW   1681 - 1750
TLNRPHPTISAHTLTTDWRLPTPRAAGSVDKESDSYSVSPSQDTDRARSSMVSTESASSTYEELARAYEH   1751 - 1820
AKMEEQLRHAKFTITECFISDTSSEQLTAGTNEYTDSLTSSTPSESGICRFTASPPKPQDGGRVMNMAVP   1821 - 1890
KAHRPGDLIHLPPYLRMDFLLNRGGPGTSRDLSLGQACLEPQKSRTLKRPTVLEPIPMEAASSASSTREG   1891 - 1960
QSWQPGAVATLPQREGAELGQAAKMSSSQESLLDSRGHLKGNNPYAKSYTLV                     1961 - 2012
//

Text Mined References (31)

PMID Year Title
25867994 2015 An analysis of gene expression in PTSD implicates genes involved in the glucocorticoid receptor pathway and neural responses to stress.
25653356 2015 Linking cell surface receptors to microtubules: tubulin folding cofactor D mediates Dscam functions during neuronal morphogenesis.
25408124 2015 Lack of association between DSCAM gene polymorphisms and adolescent idiopathic scoliosis susceptibility in a Chinese Han population.
25226531 2014 Common variation near ROBO2 is associated with expressive vocabulary in infancy.
24057671 2014 Genome-wide association study of ancestry-specific TB risk in the South African Coloured population.
24047446 2013 Genome-wide association study of co-occurring anxiety in major depression.
23671607 2013 Chromosome 21 scan in Down syndrome reveals DSCAM as a predisposing locus in Hirschsprung disease.
23518928 2013 TSPYL5 SNPs: association with plasma estradiol concentrations and aromatase expression.
23479427 2013 AMPK interacts with DSCAM and plays an important role in netrin-1 induced neurite outgrowth.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
More...