Property Summary

NCBI Gene PubMed Count 91
Grant Count 84
R01 Count 35
Funding $7,555,122.91
PubMed Score 115.96
PubTator Score 167.46

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession O60462 E9PF66 O14820 O14821 Q53TQ4 Q53TS3 Q7LBX7 Q9H2D4 Q9H2D5 Q9H2E2 Q9H2E3 Q9H2E4
Symbols NP2
NPN2
PRO2714
VEGF165R2

Gene

PDB

5DN2   2QQK   2QQL   2QQJ   2QQO   4QDQ   4QDR   4QDS  

Gene RIF (69)

PMID Text
26884342 Sequence Requirements for Neuropilin-2 Recognition by ST8SiaIV and Polysialylation of Its O-Glycans.
26753562 the concurrent high expression of VEGF-C and NRP2 is predictive of the unfavorable prognosis in glioblastoma.
26560516 NRP2/WDFY1 axis is required for maintaining endocytic activity in cancer cells, which supports their oncogenic activities and confers drug resistance.
26286962 Data show significant increases in semaphorin3C, 3D and their receptor neuropilin-2 in degenerate samples which were shown to contain nerves and blood vessels, compared to non-degenerate samples without nerves and blood vessels.
26156437 SEMA3F-NRP2 interactions inhibit intracellular PI-3K activity, mTORC2-dependent signaling, RhoA activity and cytoskeletal stress fiber formation.
26030152 the novel interplay between PAX8 and Neuropilin-2
26026587 This is the first study in the literature showing that neuropilin-2 and ezrin are related with prognosis in patients with advanced renal cell carcinoma.
25890345 Neuropilin-2 expression is inhibited by secreted Wnt antagonists and its down-regulation is associated with reduced tumor growth and metastasis in osteosarcoma
25543087 Neuropilin-2 mediates lymphangiogenesis of colorectal carcinoma via a VEGFC/VEGFR3 independent signaling.
25315821 Data show that the transmembrane (TM)domains of neuropilins 1 and 2 dimerize with themselves.
More...

AA Sequence

MDMFPLTWVFLALYFSRHQVRGQPDPPCGGRLNSKDAGYITSPGYPQDYPSHQNCEWIVYAPEPNQKIVL      1 - 70
NFNPHFEIEKHDCKYDFIEIRDGDSESADLLGKHCGNIAPPTIISSGSMLYIRFTSDYARQGAGFSLRYE     71 - 140
IFKTGSEDCSKNFTSPNGTIESPGFPEKYPHNLDCTFTILAKPKMEIILQFLIFDLEHDPLQVGEGDCKY    141 - 210
DWLDIWDGIPHVGPLIGKYCGTKTPSELRSSTGILSLTFHTDMAVAKDGFSARYYLVHQEPLENFQCNVP    211 - 280
LGMESGRIANEQISASSTYSDGRWTPQQSRLHGDDNGWTPNLDSNKEYLQVDLRFLTMLTAIATQGAISR    281 - 350
ETQNGYYVKSYKLEVSTNGEDWMVYRHGKNHKVFQANNDATEVVLNKLHAPLLTRFVRIRPQTWHSGIAL    351 - 420
RLELFGCRVTDAPCSNMLGMLSGLIADSQISASSTQEYLWSPSAARLVSSRSGWFPRIPQAQPGEEWLQV    421 - 490
DLGTPKTVKGVIIQGARGGDSITAVEARAFVRKFKVSYSLNGKDWEYIQDPRTQQPKLFEGNMHYDTPDI    491 - 560
RRFDPIPAQYVRVYPERWSPAGIGMRLEVLGCDWTDSKPTVETLGPTVKSEETTTPYPTEEEATECGENC    561 - 630
SFEDDKDLQLPSGFNCNFDFLEEPCGWMYDHAKWLRTTWASSSSPNDRTFPDDRNFLRLQSDSQREGQYA    631 - 700
RLISPPVHLPRSPVCMEFQYQATGGRGVALQVVREASQESKLLWVIREDQGGEWKHGRIILPSYDMEYQI    701 - 770
VFEGVIGKGRSGEIAIDDIRISTDVPLENCMEPISAFAGENFKVDIPEIHEREGYEDEIDDEYEVDWSNS    771 - 840
SSATSGSGAPSTDKEKSWLYTLDPILITIIAMSSLGVLLGATCAGLLLYCTCSYSGLSSRSCTTLENYNF    841 - 910
ELYDGLKHKVKMNHQKCCSEA                                                     911 - 931
//

Text Mined References (96)

PMID Year Title
26884342 2016 Sequence Requirements for Neuropilin-2 Recognition by ST8SiaIV and Polysialylation of Its O-Glycans.
26753562 2016 Concurrent Expression of VEGF-C and Neuropilin-2 Is Correlated with Poor Prognosis in Glioblastoma.
26560516 2016 Neuropilin-2 Regulates Endosome Maturation and EGFR Trafficking to Support Cancer Cell Pathobiology.
26286962 2015 Class 3 semaphorins expression and association with innervation and angiogenesis within the degenerate human intervertebral disc.
26156437 2015 Regulation of mTOR Signaling by Semaphorin 3F-Neuropilin 2 Interactions In Vitro and In Vivo.
26030152 2015 Neuropilin-2 Is a Newly Identified Target of PAX8 in Thyroid Cells.
26026587 2015 The impact of immunohistochemical staining with ezrin-carbonic anhydrase IX and neuropilin-2 on prognosis in patients with metastatic renal cell cancer receiving tyrosine kinase inhibitors.
25890345 2015 Neuropilin-2 expression is inhibited by secreted Wnt antagonists and its down-regulation is associated with reduced tumor growth and metastasis in osteosarcoma.
25543087 2015 Neuropilin-2 mediates lymphangiogenesis of colorectal carcinoma via a VEGFC/VEGFR3 independent signaling.
25315821 2014 Evidence for new homotypic and heterotypic interactions between transmembrane helices of proteins involved in receptor tyrosine kinase and neuropilin signaling.
More...