Property Summary

NCBI Gene PubMed Count 98
PubMed Score 128.15
PubTator Score 167.46

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (27)

Disease log2 FC p
adrenocortical carcinoma -1.346 1.2e-02
adult high grade glioma 1.400 7.6e-04
aldosterone-producing adenoma -1.127 3.0e-02
astrocytoma 1.500 1.3e-11
Astrocytoma, Pilocytic 1.200 7.5e-05
atypical teratoid / rhabdoid tumor 1.500 2.2e-03
Breast cancer 2.700 2.9e-02
colon cancer -2.600 2.9e-05
cystic fibrosis 1.535 2.9e-05
gastric carcinoma 1.900 2.5e-02
glioblastoma 1.200 3.3e-03
interstitial cystitis 1.400 2.9e-02
intraductal papillary-mucinous neoplasm ... 2.800 2.3e-03
invasive ductal carcinoma 1.383 1.3e-02
lung cancer 2.600 4.2e-03
lung carcinoma -1.800 1.0e-22
malignant mesothelioma -1.400 2.1e-06
medulloblastoma, large-cell 1.700 1.2e-03
mucosa-associated lymphoid tissue lympho... 2.021 4.8e-02
oligodendroglioma 1.300 1.3e-08
osteosarcoma 1.239 3.6e-03
ovarian cancer -1.100 3.9e-02
pancreatic cancer 1.200 3.9e-03
posterior fossa group A ependymoma 1.200 8.5e-03
primitive neuroectodermal tumor 1.800 3.8e-03
subependymal giant cell astrocytoma 1.106 1.6e-02
tuberculosis -1.700 2.2e-05

 GWAS Trait (1)

Protein-protein Interaction (1)

Gene RIF (75)

AA Sequence

MDMFPLTWVFLALYFSRHQVRGQPDPPCGGRLNSKDAGYITSPGYPQDYPSHQNCEWIVYAPEPNQKIVL      1 - 70
NFNPHFEIEKHDCKYDFIEIRDGDSESADLLGKHCGNIAPPTIISSGSMLYIRFTSDYARQGAGFSLRYE     71 - 140
IFKTGSEDCSKNFTSPNGTIESPGFPEKYPHNLDCTFTILAKPKMEIILQFLIFDLEHDPLQVGEGDCKY    141 - 210
DWLDIWDGIPHVGPLIGKYCGTKTPSELRSSTGILSLTFHTDMAVAKDGFSARYYLVHQEPLENFQCNVP    211 - 280
LGMESGRIANEQISASSTYSDGRWTPQQSRLHGDDNGWTPNLDSNKEYLQVDLRFLTMLTAIATQGAISR    281 - 350
ETQNGYYVKSYKLEVSTNGEDWMVYRHGKNHKVFQANNDATEVVLNKLHAPLLTRFVRIRPQTWHSGIAL    351 - 420
RLELFGCRVTDAPCSNMLGMLSGLIADSQISASSTQEYLWSPSAARLVSSRSGWFPRIPQAQPGEEWLQV    421 - 490
DLGTPKTVKGVIIQGARGGDSITAVEARAFVRKFKVSYSLNGKDWEYIQDPRTQQPKLFEGNMHYDTPDI    491 - 560
RRFDPIPAQYVRVYPERWSPAGIGMRLEVLGCDWTDSKPTVETLGPTVKSEETTTPYPTEEEATECGENC    561 - 630
SFEDDKDLQLPSGFNCNFDFLEEPCGWMYDHAKWLRTTWASSSSPNDRTFPDDRNFLRLQSDSQREGQYA    631 - 700
RLISPPVHLPRSPVCMEFQYQATGGRGVALQVVREASQESKLLWVIREDQGGEWKHGRIILPSYDMEYQI    701 - 770
VFEGVIGKGRSGEIAIDDIRISTDVPLENCMEPISAFAGENFKVDIPEIHEREGYEDEIDDEYEVDWSNS    771 - 840
SSATSGSGAPSTDKEKSWLYTLDPILITIIAMSSLGVLLGATCAGLLLYCTCSYSGLSSRSCTTLENYNF    841 - 910
ELYDGLKHKVKMNHQKCCSEA                                                     911 - 931
//

Text Mined References (103)

PMID Year Title