Property Summary

NCBI Gene PubMed Count 32
PubMed Score 210.07
PubTator Score 81.43

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
adult high grade glioma 1.700 6.8e-03
Astrocytoma, Pilocytic 2.100 1.2e-06
Breast cancer -3.200 2.2e-14
breast carcinoma -1.200 1.9e-10
cystic fibrosis -1.500 2.4e-03
Endometriosis -1.366 1.2e-02
esophageal adenocarcinoma 1.600 3.3e-02
gastric carcinoma 1.900 2.7e-02
glioblastoma 1.500 8.0e-03
intraductal papillary-mucinous adenoma (... 1.900 2.1e-02
intraductal papillary-mucinous neoplasm ... 3.400 8.9e-03
lung cancer -1.100 4.9e-03
nephrosclerosis 1.244 6.7e-03
osteosarcoma -2.935 8.0e-04
ovarian cancer 1.500 5.6e-03
pancreatic cancer 2.000 8.0e-05
posterior fossa group A ependymoma 1.200 1.9e-03
primary Sjogren syndrome 1.400 1.2e-02
sarcoidosis 1.600 1.8e-02
subependymal giant cell astrocytoma 1.542 2.4e-02
tuberculosis 1.100 5.1e-04

Gene RIF (23)

AA Sequence

MRTGWATPRRPAGLLMLLFWFFDLAEPSGRAANDPFTIVHGNTGKCIKPVYGWIVADDCDETEDKLWKWV      1 - 70
SQHRLFHLHSQKCLGLDITKSVNELRMFSCDSSAMLWWKCEHHSLYGAARYRLALKDGHGTAISNASDVW     71 - 140
KKGGSEESLCDQPYHEIYTRDGNSYGRPCEFPFLIDGTWHHDCILDEDHSGPWCATTLNYEYDRKWGICL    141 - 210
KPENGCEDNWEKNEQFGSCYQFNTQTALSWKEAYVSCQNQGADLLSINSAAELTYLKEKEGIAKIFWIGL    211 - 280
NQLYSARGWEWSDHKPLNFLNWDPDRPSAPTIGGSSCARMDAESGLWQSFSCEAQLPYVCRKPLNNTVEL    281 - 350
TDVWTYSDTRCDAGWLPNNGFCYLLVNESNSWDKAHAKCKAFSSDLISIHSLADVEVVVTKLHNEDIKEE    351 - 420
VWIGLKNINIPTLFQWSDGTEVTLTYWDENEPNVPYNKTPNCVSYLGELGQWKVQSCEEKLKYVCKRKGE    421 - 490
KLNDASSDKMCPPDEGWKRHGETCYKIYEDEVPFGTNCNLTITSRFEQEYLNDLMKKYDKSLRKYFWTGL    491 - 560
RDVDSCGEYNWATVGGRRRAVTFSNWNFLEPASPGGCVAMSTGKSVGKWEVKDCRSFKALSICKKMSGPL    561 - 630
GPEEASPKPDDPCPEGWQSFPASLSCYKVFHAERIVRKRNWEEAERFCQALGAHLSSFSHVDEIKEFLHF    631 - 700
LTDQFSGQHWLWIGLNKRSPDLQGSWQWSDRTPVSTIIMPNEFQQDYDIRDCAAVKVFHRPWRRGWHFYD    701 - 770
DREFIYLRPFACDTKLEWVCQIPKGRTPKTPDWYNPDRAGIHGPPLIIEGSEYWFVADLHLNYEEAVLYC    771 - 840
ASNHSFLATITSFVGLKAIKNKIANISGDGQKWWIRISEWPIDDHFTYSRYPWHRFPVTFGEECLYMSAK    841 - 910
TWLIDLGKPTDCSTKLPFICEKYNVSSLEKYSPDSAAKVQCSEQWIPFQNKCFLKIKPVSLTFSQASDTC    911 - 980
HSYGGTLPSVLSQIEQDFITSLLPDMEATLWIGLRWTAYEKINKWTDNRELTYSNFHPLLVSGRLRIPEN    981 - 1050
FFEEESRYHCALILNLQKSPFTGTWNFTSCSERHFVSLCQKYSEVKSRQTLQNASETVKYLNNLYKIIPK   1051 - 1120
TLTWHSAKRECLKSNMQLVSITDPYQQAFLSVQALLHNSSLWIGLFSQDDELNFGWSDGKRLHFSRWAET   1121 - 1190
NGQLEDCVVLDTDGFWKTVDCNDNQPGAICYYSGNETEKEVKPVDSVKCPSPVLNTPWIPFQNCCYNFII   1191 - 1260
TKNRHMATTQDEVHTKCQKLNPKSHILSIRDEKENNFVLEQLLYFNYMASWVMLGITYRNKSLMWFDKTP   1261 - 1330
LSYTHWRAGRPTIKNEKFLAGLSTDGFWDIQTFKVIEEAVYFHQHSILACKIEMVDYKEEYNTTLPQFMP   1331 - 1400
YEDGIYSVIQKKVTWYEALNMCSQSGGHLASVHNQNGQLFLEDIVKRDGFPLWVGLSSHDGSESSFEWSD   1401 - 1470
GSTFDYIPWKGQTSPGNCVLLDPKGTWKHEKCNSVKDGAICYKPTKSKKLSRLTYSSRCPAAKENGSRWI   1471 - 1540
QYKGHCYKSDQALHSFSEAKKLCSKHDHSATIVSIKDEDENKFVSRLMRENNNITMRVWLGLSQHSVDQS   1541 - 1610
WSWLDGSEVTFVKWENKSKSGVGRCSMLIASNETWKKVECEHGFGRVVCKVPLGPDYTAIAIIVATLSIL   1611 - 1680
VLMGGLIWFLFQRHRLHLAGFSSVRYAQGVNEDEIMLPSFHD                               1681 - 1722
//

Text Mined References (34)

PMID Year Title