Property Summary

NCBI Gene PubMed Count 29
PubMed Score 202.25
PubTator Score 81.43

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
Breast cancer 3099 2.16294851052042E-14
breast carcinoma 1614 1.89661080802416E-10
pilocytic astrocytoma 3086 1.31049828292141E-6
lung cancer 4473 2.24395080903525E-6
pancreatic cancer 2300 7.95888193472251E-5
tuberculosis 1563 5.06769863903984E-4
osteosarcoma 7933 7.95280282383426E-4
posterior fossa group A ependymoma 1511 0.00186744506452946
cystic fibrosis 1670 0.00242515754176199
ovarian cancer 8492 0.00560310979332236
pediatric high grade glioma 2712 0.00595050492245418
nephrosclerosis 329 0.00666648574707398
glioblastoma 5572 0.00800119757278849
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00886609841431181
primary Sjogren syndrome 789 0.0115815432540376
Endometriosis 535 0.0118786602891748
sarcoidosis 368 0.0179630738791401
intraductal papillary-mucinous adenoma (IPMA) 2956 0.020993519924185
subependymal giant cell astrocytoma 2287 0.0238261088064094
gastric carcinoma 832 0.0268894746604656
esophageal adenocarcinoma 737 0.0330622508020077
Disease Target Count Z-score Confidence
Plague 19 3.507 1.8
Lipid pneumonia 1 3.369 1.7
Adenoiditis 5 3.063 1.5
Cancer 2346 3.037 1.5

Expression

  Differential Expression (21)

Disease log2 FC p
nephrosclerosis 1.244 0.007
esophageal adenocarcinoma 1.600 0.033
osteosarcoma -2.935 0.001
glioblastoma 1.500 0.008
tuberculosis 1.100 0.001
intraductal papillary-mucinous adenoma (... 1.900 0.021
intraductal papillary-mucinous neoplasm ... 3.400 0.009
lung cancer -4.000 0.000
sarcoidosis 1.600 0.018
pancreatic cancer 2.000 0.000
cystic fibrosis -1.500 0.002
pediatric high grade glioma 1.800 0.006
pilocytic astrocytoma 2.100 0.000
posterior fossa group A ependymoma 1.200 0.002
primary Sjogren syndrome 1.400 0.012
subependymal giant cell astrocytoma 1.542 0.024
Endometriosis -1.366 0.012
Breast cancer -3.200 0.000
breast carcinoma -1.200 0.000
gastric carcinoma 1.900 0.027
ovarian cancer 1.500 0.006

Synonym

Accession O60449 O75913 Q53R46 Q53TF5 Q7Z575 Q7Z577 Ly-75
Symbols CD205
LY-75
CLEC13B
DEC-205
GP200-MR6

Gene

PANTHER Protein Class (1)

Gene RIF (18)

PMID Text
26039988 results suggest that DEC205 is an immune receptor that recognizes apoptotic and necrotic cells specifically through a pH-dependent mechanism
25557950 Variants in LY75 were associated with a Crohn's disease phenotype involving erythema nodosum.
24702227 elevated in cholesteatoma
24667918 Microarray analysis indicates HIV-1 Tat-induced upregulation of lymphocyte antigen 75 (LY75) in primary human brain microvascular endothelial cells
22988114 DEC-205 is a cell surface receptor for CpG olligonucleotides.
22865700 The most significantly associated SNPs to type 2 diabetes mellitus in this study are expression SNPs to the lymphocyte antigen 75 gene, the ubiquitin-specific peptidase 36 gene, and the phosphatidylinositol transfer protein, cytoplasmic 1 gene.
22841832 Data indicate that the interaction between the PE-Cy5.5 conjugates and the cells expressing mDEC205 appears distinctive, since none of the PE-Cy5.5 conjugates bind to the cells that express human DEC205 on surface.
22736794 CD205+ conventional dendritic cells impacts the regulation of T-cell immunity and homeostasis in vivo
21887537 Upregulation of LY75 is associated with ovarian tumor.
21413003 observed that TLR-mediated signaling increases DEC-205 expression levels without affecting receptor internalization
More...

AA Sequence

MRTGWATPRRPAGLLMLLFWFFDLAEPSGRAANDPFTIVHGNTGKCIKPVYGWIVADDCDETEDKLWKWV      1 - 70
SQHRLFHLHSQKCLGLDITKSVNELRMFSCDSSAMLWWKCEHHSLYGAARYRLALKDGHGTAISNASDVW     71 - 140
KKGGSEESLCDQPYHEIYTRDGNSYGRPCEFPFLIDGTWHHDCILDEDHSGPWCATTLNYEYDRKWGICL    141 - 210
KPENGCEDNWEKNEQFGSCYQFNTQTALSWKEAYVSCQNQGADLLSINSAAELTYLKEKEGIAKIFWIGL    211 - 280
NQLYSARGWEWSDHKPLNFLNWDPDRPSAPTIGGSSCARMDAESGLWQSFSCEAQLPYVCRKPLNNTVEL    281 - 350
TDVWTYSDTRCDAGWLPNNGFCYLLVNESNSWDKAHAKCKAFSSDLISIHSLADVEVVVTKLHNEDIKEE    351 - 420
VWIGLKNINIPTLFQWSDGTEVTLTYWDENEPNVPYNKTPNCVSYLGELGQWKVQSCEEKLKYVCKRKGE    421 - 490
KLNDASSDKMCPPDEGWKRHGETCYKIYEDEVPFGTNCNLTITSRFEQEYLNDLMKKYDKSLRKYFWTGL    491 - 560
RDVDSCGEYNWATVGGRRRAVTFSNWNFLEPASPGGCVAMSTGKSVGKWEVKDCRSFKALSICKKMSGPL    561 - 630
GPEEASPKPDDPCPEGWQSFPASLSCYKVFHAERIVRKRNWEEAERFCQALGAHLSSFSHVDEIKEFLHF    631 - 700
LTDQFSGQHWLWIGLNKRSPDLQGSWQWSDRTPVSTIIMPNEFQQDYDIRDCAAVKVFHRPWRRGWHFYD    701 - 770
DREFIYLRPFACDTKLEWVCQIPKGRTPKTPDWYNPDRAGIHGPPLIIEGSEYWFVADLHLNYEEAVLYC    771 - 840
ASNHSFLATITSFVGLKAIKNKIANISGDGQKWWIRISEWPIDDHFTYSRYPWHRFPVTFGEECLYMSAK    841 - 910
TWLIDLGKPTDCSTKLPFICEKYNVSSLEKYSPDSAAKVQCSEQWIPFQNKCFLKIKPVSLTFSQASDTC    911 - 980
HSYGGTLPSVLSQIEQDFITSLLPDMEATLWIGLRWTAYEKINKWTDNRELTYSNFHPLLVSGRLRIPEN    981 - 1050
FFEEESRYHCALILNLQKSPFTGTWNFTSCSERHFVSLCQKYSEVKSRQTLQNASETVKYLNNLYKIIPK   1051 - 1120
TLTWHSAKRECLKSNMQLVSITDPYQQAFLSVQALLHNSSLWIGLFSQDDELNFGWSDGKRLHFSRWAET   1121 - 1190
NGQLEDCVVLDTDGFWKTVDCNDNQPGAICYYSGNETEKEVKPVDSVKCPSPVLNTPWIPFQNCCYNFII   1191 - 1260
TKNRHMATTQDEVHTKCQKLNPKSHILSIRDEKENNFVLEQLLYFNYMASWVMLGITYRNKSLMWFDKTP   1261 - 1330
LSYTHWRAGRPTIKNEKFLAGLSTDGFWDIQTFKVIEEAVYFHQHSILACKIEMVDYKEEYNTTLPQFMP   1331 - 1400
YEDGIYSVIQKKVTWYEALNMCSQSGGHLASVHNQNGQLFLEDIVKRDGFPLWVGLSSHDGSESSFEWSD   1401 - 1470
GSTFDYIPWKGQTSPGNCVLLDPKGTWKHEKCNSVKDGAICYKPTKSKKLSRLTYSSRCPAAKENGSRWI   1471 - 1540
QYKGHCYKSDQALHSFSEAKKLCSKHDHSATIVSIKDEDENKFVSRLMRENNNITMRVWLGLSQHSVDQS   1541 - 1610
WSWLDGSEVTFVKWENKSKSGVGRCSMLIASNETWKKVECEHGFGRVVCKVPLGPDYTAIAIIVATLSIL   1611 - 1680
VLMGGLIWFLFQRHRLHLAGFSSVRYAQGVNEDEIMLPSFHD                               1681 - 1722
//

Text Mined References (31)

PMID Year Title
26039988 2015 pH-Dependent recognition of apoptotic and necrotic cells by the human dendritic cell receptor DEC205.
25557950 2015 Identification of risk loci for Crohn's disease phenotypes using a genome-wide association study.
25416956 2014 A proteome-scale map of the human interactome network.
24702227 2014 Increased expression of Dec-205, Bcl-10, Tim-3, and Trem-1 mRNA in chronic otitis media with cholesteatoma.
22988114 2012 DEC-205 is a cell surface receptor for CpG oligonucleotides.
22865700 2012 Integrating genetic association, genetics of gene expression, and single nucleotide polymorphism set analysis to identify susceptibility Loci for type 2 diabetes mellitus.
22841832 2012 PE-Cy5.5 conjugates bind to the cells expressing mouse DEC205/CD205.
22736794 2012 Conditional ablation of CD205+ conventional dendritic cells impacts the regulation of T-cell immunity and homeostasis in vivo.
21887537 2011 Interleukin-6 receptor enhances early colonization of the murine omentum by upregulation of a mannose family receptor, LY75, in ovarian tumor cells.
21413003 2011 DEC-205 mediates antigen uptake and presentation by both resting and activated human plasmacytoid dendritic cells.
More...