Property Summary

NCBI Gene PubMed Count 30
PubMed Score 20.51
PubTator Score 14.97

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
adult high grade glioma -1.400 2.7e-03
atypical teratoid / rhabdoid tumor -1.200 3.6e-03
diabetes mellitus -1.100 1.2e-03
ependymoma 1.200 3.3e-05
glioblastoma -1.100 1.8e-02
group 4 medulloblastoma -1.100 9.0e-03
intraductal papillary-mucinous adenoma (... 2.200 3.7e-04
intraductal papillary-mucinous carcinoma... 1.500 8.5e-04
invasive ductal carcinoma -1.100 3.5e-03
malignant mesothelioma -1.800 1.0e-05
medulloblastoma, large-cell -1.900 9.2e-06
mucosa-associated lymphoid tissue lympho... 1.162 9.2e-03
ovarian cancer -2.000 2.3e-09
pancreatic cancer 1.200 6.6e-03
pancreatic carcinoma 1.200 6.6e-03
psoriasis -2.700 1.2e-05
Rheumatoid arthritis 1.400 2.6e-03
tuberculosis and treatment for 3 months 1.200 1.3e-04

Gene RIF (15)

AA Sequence

MVTNKMTAAFRNPSGKQVATDKVAEKLSSTLSWVKNTVSHTVSQMASQVASPSTSLHTTSSSTTLSTPAL      1 - 70
SPSSPSQLSPDDLELLAKLEEQNRLLETDSKSLRSVNGSRRNSGSSLVSSSSASSNLSHLEEDSWILWGR     71 - 140
IVNEWEDVRKKKEKQVKELVHKGIPHHFRAIVWQLLCSAQSMPIKDQYSELLKMTSPCEKLIRRDIARTY    141 - 210
PEHNFFKEKDSLGQEVLFNVMKAYSLVDREVGYCQGSAFIVGLLLMQMPEEEAFCVFVKLMQDYRLRELF    211 - 280
KPSMAELGLCMYQFECMIQEHLPELFVHFQSQSFHTSMYASSWFLTIFLTTFPLPIATRIFDIFMSEGLE    281 - 350
IVFRVGLALLQMNQAELMQLDMEGMLQHFQKVIPHQFDGVPDKLIQAAYQVKYNSKKMKKLEKEYTTIKT    351 - 420
KEMEEQVEIKRLRTENRLLKQRIETLEKHKCSSNYNEDFVLQLEKELVQARLSEAESQCALKEMQDKVLD    421 - 490
IEKRNNSLPDENNIARLQEELIAVKLREAEAIMGLKELRQQVKDLEEHWQRHLARTTGRWKDPPKKNAMN    491 - 560
ELQDELMTIRLREAETQAEIREIKQRMMEMETQNQINSNHLRRAEQEVISLQEKVQYLSAQNKGLLTQLS    561 - 630
EAKRKQAEIECKNKEEVMAVRLREADSIAAVAELRQHIAELEIQKEEGKLQGQLNKSDSNQYIGELKDQI    631 - 700
AELNHELRCLKGQRGFSGQPPFDGIHIVNHLIGDDESFHSSDEDFIDNSLQETGVGFPLHGKSGSMSLDP    701 - 770
AVADGSESETEDSVLETRESNQVVQKERPPRRRESYSTTV                                  771 - 810
//

Text Mined References (33)

PMID Year Title