Property Summary

NCBI Gene PubMed Count 29
Grant Count 19
R01 Count 16
Funding $1,795,147.09
PubMed Score 17.46
PubTator Score 14.97

Knowledge Summary

Patent

No data available

Expression

Gene RIF (15)

PMID Text
26433934 EVI5 as a strong candidate disease risk gene in the 1p22.1 multiple sclerosis risk locus
25537516 Data show that heat shock transcription factor 1/miR-135b/reversion-inducing-cysteine-rich protein with kazal motifs and ecotropic viral integration site 5 axis provides novel insight into the mechanisms of hepatocellular carcinoma metastasis.
24130709 in HLA-DRB1 positive patients, EVI5 was associated with attacks of greater severity and worse recovery in Multiple sclerosis .
23669355 cellular functions exhibited by the Evi5 family members
20087403 An analysis and fine mapping of GFI-EVI5-RPL5-FAM69A locus, genotyping eight Tag-single nucleotide polymorphisms in 732 multiple sclerosis patients and 974 controls from Spain, was performed.
20087403 Observational study of gene-disease association. (HuGE Navigator)
20008790 Stem cell exhaustion due to Runx1 deficiency is prevented by Evi5 activation in leukemogenesis.
19865102 Observational study of gene-disease association. (HuGE Navigator)
19834503 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
19506219 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MVTNKMTAAFRNPSGKQVATDKVAEKLSSTLSWVKNTVSHTVSQMASQVASPSTSLHTTSSSTTLSTPAL      1 - 70
SPSSPSQLSPDDLELLAKLEEQNRLLETDSKSLRSVNGSRRNSGSSLVSSSSASSNLSHLEEDSWILWGR     71 - 140
IVNEWEDVRKKKEKQVKELVHKGIPHHFRAIVWQLLCSAQSMPIKDQYSELLKMTSPCEKLIRRDIARTY    141 - 210
PEHNFFKEKDSLGQEVLFNVMKAYSLVDREVGYCQGSAFIVGLLLMQMPEEEAFCVFVKLMQDYRLRELF    211 - 280
KPSMAELGLCMYQFECMIQEHLPELFVHFQSQSFHTSMYASSWFLTIFLTTFPLPIATRIFDIFMSEGLE    281 - 350
IVFRVGLALLQMNQAELMQLDMEGMLQHFQKVIPHQFDGVPDKLIQAAYQVKYNSKKMKKLEKEYTTIKT    351 - 420
KEMEEQVEIKRLRTENRLLKQRIETLEKHKCSSNYNEDFVLQLEKELVQARLSEAESQCALKEMQDKVLD    421 - 490
IEKRNNSLPDENNIARLQEELIAVKLREAEAIMGLKELRQQVKDLEEHWQRHLARTTGRWKDPPKKNAMN    491 - 560
ELQDELMTIRLREAETQAEIREIKQRMMEMETQNQINSNHLRRAEQEVISLQEKVQYLSAQNKGLLTQLS    561 - 630
EAKRKQAEIECKNKEEVMAVRLREADSIAAVAELRQHIAELEIQKEEGKLQGQLNKSDSNQYIGELKDQI    631 - 700
AELNHELRCLKGQRGFSGQPPFDGIHIVNHLIGDDESFHSSDEDFIDNSLQETGVGFPLHGKSGSMSLDP    701 - 770
AVADGSESETEDSVLETRESNQVVQKERPPRRRESYSTTV                                  771 - 810
//

Text Mined References (32)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26433934 2015 A non-synonymous single-nucleotide polymorphism associated with multiple sclerosis risk affects the EVI5 interactome.
25537516 2015 MicroRNA-135b, a HSF1 target, promotes tumor invasion and metastasis by regulating RECK and EVI5 in hepatocellular carcinoma.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24130709 2013 Multiple sclerosis susceptibility genes: associations with relapse severity and recovery.
24097068 2013 Discovery and refinement of loci associated with lipid levels.
23669355 2013 The Evi5 family in cellular physiology and pathology.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21833088 2011 Genetic risk and a primary role for cell-mediated immune mechanisms in multiple sclerosis.
20686565 2010 Biological, clinical and population relevance of 95 loci for blood lipids.
More...