Property Summary

NCBI Gene PubMed Count 41
PubMed Score 269.82
PubTator Score 40.89

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
acute quadriplegic myopathy 1.060 5.5e-04
astrocytic glioma -1.800 5.9e-04
Astrocytoma, Pilocytic -1.500 2.2e-03
Breast cancer -1.400 5.4e-08
breast carcinoma -1.400 2.6e-06
ductal carcinoma in situ -2.100 1.9e-04
esophageal adenocarcinoma -3.100 1.8e-02
glioblastoma -1.200 2.0e-02
interstitial cystitis -1.600 6.2e-03
invasive ductal carcinoma -2.054 4.4e-05
lung cancer -3.500 2.7e-02
medulloblastoma, large-cell -1.400 2.5e-02
nasopharyngeal carcinoma -2.200 9.0e-06
oligodendroglioma -1.300 4.4e-13
ovarian cancer -1.700 6.8e-07
Pick disease -1.200 2.8e-02
primitive neuroectodermal tumor -2.000 7.7e-04
sonic hedgehog group medulloblastoma -1.100 2.8e-02
spina bifida -1.806 4.5e-02

 MGI Phenotype (1)

Protein-protein Interaction (10)

Gene RIF (21)

AA Sequence

MNSLFRKRNKGKYSPTVQTRSISNKELSELIEQLQKNADQVEKNIVDTEAKMQSDLARLQEGRQPEHRDV      1 - 70
TLQKVLDSEKLLYVLEADAAIAKHMKHPQGDMIAEDIRQLKERVTNLRGKHKQIYRLAVKEVDPQVNWAA     71 - 140
LVEEKLDKLNNQSFGTDLPLVDHQVEEHNIFHNEVKAIGPHLAKDGDKEQNSELRAKYQKLLAASQARQQ    141 - 210
HLSSLQDYMQRCTNELYWLDQQAKGRMQYDWSDRNLDYPSRRRQYENFINRNLEAKEERINKLHSEGDQL    211 - 280
LAAEHPGRNSIEAHMEAVHADWKEYLNLLICEESHLKYMEDYHQFHEDVKDAQELLRKVDSDLNQKYGPD    281 - 350
FKDRYQIELLLRELDDQEKVLDKYEDVVQGLQKRGQQVVPLKYRRETPLKPIPVEALCDFEGEQGLISRG    351 - 420
YSYTLQKNNGESWELMDSAGNKLIAPAVCFVIPPTDPEALALADSLGSQYRSVRQKAAGSKRTLQQRYEV    421 - 490
LKTENPGDASDLQGRQLLAGLDKVASDLDRQEKAITGILRPPLEQGRAVQDSAERAKDLKNITNELLRIE    491 - 560
PEKTRSTAEGEAFIQALPGSGTTPLLRTRVEDTNRKYEHLLQLLDLAQEKVDVANRLEKSLQQSWELLAT    561 - 630
HENHLNQDDTVPESSRVLDSKGQELAAMACELQAQKSLLGEVEQNLQAAKQCSSTLASRFQEHCPDLERQ    631 - 700
EAEVHKLGQRFNNLRQQVERRAQSLQSAKAAYEHFHRGHDHVLQFLVSIPSYEPQETDSLSQMETKLKNQ    701 - 770
KNLLDEIASREQEVQKICANSQQYQQAVKDYELEAEKLRSLLDLENGRRSHVSKRARLQSPATKVKEEEA    771 - 840
ALAAKFTEVYAINRQRLQNLEFALNLLRQQPEVEVTHETLQRNRPDSGVEEAWKIRKELDEETERRRQLE    841 - 910
NEVKSTQEEIWTLRNQGPQESVVRKEVLKKVPDPVLEESFQQLQRTLAEEQHKNQLLQEELEALQLQLRA    911 - 980
LEQETRDGGQEYVVKEVLRIEPDRAQADEVLQLREELEALRRQKGAREAEVLLLQQRVAALAEEKSRAQE    981 - 1050
KVTEKEVVKLQNDPQLEAEYQQLQEDHQRQDQLREKQEEELSFLQDKLKRLEKERAMAEGKITVKEVLKV   1051 - 1120
EKDAATEREVSDLTRQYEDEAAKARASQREKTELLRKIWALEEENAKVVVQEKVREIVRPDPKAESEVAN   1121 - 1190
LRLELVEQERKYRGAEEQLRSYQSELEALRRRGPQVEVKEVTKEVIKYKTDPEMEKELQRLREEIVDKTR   1191 - 1260
LIERCDLEIYQLKKEIQALKDTKPQVQTKEVVQEILQFQEDPQTKEEVASLRAKLSEEQKKQVDLERERA   1261 - 1330
SQEEQIARKEEELSRVKERVVQQEVVRYEEEPGLRAEASAFAESIDVELRQIDKLRAELRRLQRRRTELE   1331 - 1400
RQLEELERERQARREAEREVQRLQQRLAALEQEEAEAREKVTHTQKVVLQQDPQQAREHALLRLQLEEEQ   1401 - 1470
HRRQLLEGELETLRRKLAALEKAEVKEKVVLSESVQVEKGDTEQEIQRLKSSLEEESRSKRELDVEVSRL   1471 - 1540
EARLSELEFHNSKSSKELDFLREENHKLQLERQNLQLETRRLQSEINMAATETRDLRNMTVADSGTNHDS   1541 - 1610
RLWSLERELDDLKRLSKDKDLEIDELQKRLGSVAVKREQRENHLRRSIVVIHPDTGRELSPEEAHRAGLI   1611 - 1680
DWNMFVKLRSQECDWEEISVKGPNGESSVIHDRKSGKKFSIEEALQSGRLTPAQYDRYVNKDMSIQELAV   1681 - 1750
LVSGQK                                                                   1751 - 1756
//

Text Mined References (47)

PMID Year Title