Property Summary

NCBI Gene PubMed Count 39
PubMed Score 258.91
PubTator Score 40.89

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
oligodendroglioma 2849 4.37008992370711E-13
Breast cancer 3099 5.40585245252253E-8
ovarian cancer 8492 6.75186808620279E-7
breast carcinoma 1614 2.59509253431868E-6
nasopharyngeal carcinoma 1056 9.03208225602009E-6
interstitial cystitis 2299 1.02980087907426E-4
ductal carcinoma in situ 1745 1.87600355460609E-4
acute quadriplegic myopathy 1157 5.53817612332498E-4
astrocytic glioma 2241 5.89586879199611E-4
invasive ductal carcinoma 2950 6.50107145616311E-4
primitive neuroectodermal tumor 3031 7.7074604159894E-4
pilocytic astrocytoma 3086 0.00279029148980376
esophageal adenocarcinoma 737 0.0176010007179145
glioblastoma 5572 0.0198824587805291
medulloblastoma, large-cell 6234 0.0253936957675572
lung cancer 4473 0.0267547646008768
Pick disease 1893 0.0278385001073017
sonic hedgehog group medulloblastoma 1482 0.0281899189217313
spina bifida 1064 0.0448751530129997
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0

Expression

  Differential Expression (19)

Disease log2 FC p
astrocytic glioma -1.800 0.001
esophageal adenocarcinoma -3.100 0.018
oligodendroglioma -1.300 0.000
glioblastoma -1.200 0.020
medulloblastoma, large-cell -1.400 0.025
primitive neuroectodermal tumor -2.000 0.001
acute quadriplegic myopathy 1.060 0.001
lung cancer -3.500 0.027
breast carcinoma -1.400 0.000
interstitial cystitis -2.400 0.000
pilocytic astrocytoma -1.500 0.003
sonic hedgehog group medulloblastoma -1.100 0.028
invasive ductal carcinoma -2.700 0.001
nasopharyngeal carcinoma -2.200 0.000
spina bifida -1.806 0.045
Pick disease -1.200 0.028
Breast cancer -1.400 0.000
ductal carcinoma in situ -2.100 0.000
ovarian cancer -1.700 0.000

Synonym

Accession O60437 O60314 O60454 Q14C98
Symbols

Gene

PPL

PDB

4Q28  

  Ortholog (8)

Species Source
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA Inparanoid
Opossum OMA EggNOG Inparanoid
Chicken OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

 GO Process (1)

 MGI Term (1)

Gene RIF (19)

PMID Text
25637025 Human gamma-delta T cells are activated by cytosolic interactions of BTN3A1 with soluble phosphoantigens and the cytoskeletal adaptor periplakin.
25520130 Low serum periplakin is associated with urothelial carcinoma.
24942859 Loss of periplakin expression is associated with pathological stage and cancer-specific survival in patients with urothelial carcinoma of the urinary bladder.
22841549 Annexin A9 and periplakin co-localise in the epidermis and annexin A9 is up-regulated in differentiating keratinocytes, but the epidermal annexin A9 expression does not require periplakin.
21951621 involved in cellular movement and attachment in pharyngeal squamous cancer cells
20468064 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19211270 Sciellin, SPRR3, and periplakin transcripts were all upregulated (4.67-, 4.95-, 2.77-fold, respectively) by prolonged exposure to cyclic strain (24-72 h), but not at earlier time points.
18820940 autoantibodies are detected in patients with paraneoplastic pemphigus
17662978 A novel functional co-localisation is identified between two plakin cytolinker proteins.
More...

AA Sequence

MNSLFRKRNKGKYSPTVQTRSISNKELSELIEQLQKNADQVEKNIVDTEAKMQSDLARLQEGRQPEHRDV      1 - 70
TLQKVLDSEKLLYVLEADAAIAKHMKHPQGDMIAEDIRQLKERVTNLRGKHKQIYRLAVKEVDPQVNWAA     71 - 140
LVEEKLDKLNNQSFGTDLPLVDHQVEEHNIFHNEVKAIGPHLAKDGDKEQNSELRAKYQKLLAASQARQQ    141 - 210
HLSSLQDYMQRCTNELYWLDQQAKGRMQYDWSDRNLDYPSRRRQYENFINRNLEAKEERINKLHSEGDQL    211 - 280
LAAEHPGRNSIEAHMEAVHADWKEYLNLLICEESHLKYMEDYHQFHEDVKDAQELLRKVDSDLNQKYGPD    281 - 350
FKDRYQIELLLRELDDQEKVLDKYEDVVQGLQKRGQQVVPLKYRRETPLKPIPVEALCDFEGEQGLISRG    351 - 420
YSYTLQKNNGESWELMDSAGNKLIAPAVCFVIPPTDPEALALADSLGSQYRSVRQKAAGSKRTLQQRYEV    421 - 490
LKTENPGDASDLQGRQLLAGLDKVASDLDRQEKAITGILRPPLEQGRAVQDSAERAKDLKNITNELLRIE    491 - 560
PEKTRSTAEGEAFIQALPGSGTTPLLRTRVEDTNRKYEHLLQLLDLAQEKVDVANRLEKSLQQSWELLAT    561 - 630
HENHLNQDDTVPESSRVLDSKGQELAAMACELQAQKSLLGEVEQNLQAAKQCSSTLASRFQEHCPDLERQ    631 - 700
EAEVHKLGQRFNNLRQQVERRAQSLQSAKAAYEHFHRGHDHVLQFLVSIPSYEPQETDSLSQMETKLKNQ    701 - 770
KNLLDEIASREQEVQKICANSQQYQQAVKDYELEAEKLRSLLDLENGRRSHVSKRARLQSPATKVKEEEA    771 - 840
ALAAKFTEVYAINRQRLQNLEFALNLLRQQPEVEVTHETLQRNRPDSGVEEAWKIRKELDEETERRRQLE    841 - 910
NEVKSTQEEIWTLRNQGPQESVVRKEVLKKVPDPVLEESFQQLQRTLAEEQHKNQLLQEELEALQLQLRA    911 - 980
LEQETRDGGQEYVVKEVLRIEPDRAQADEVLQLREELEALRRQKGAREAEVLLLQQRVAALAEEKSRAQE    981 - 1050
KVTEKEVVKLQNDPQLEAEYQQLQEDHQRQDQLREKQEEELSFLQDKLKRLEKERAMAEGKITVKEVLKV   1051 - 1120
EKDAATEREVSDLTRQYEDEAAKARASQREKTELLRKIWALEEENAKVVVQEKVREIVRPDPKAESEVAN   1121 - 1190
LRLELVEQERKYRGAEEQLRSYQSELEALRRRGPQVEVKEVTKEVIKYKTDPEMEKELQRLREEIVDKTR   1191 - 1260
LIERCDLEIYQLKKEIQALKDTKPQVQTKEVVQEILQFQEDPQTKEEVASLRAKLSEEQKKQVDLERERA   1261 - 1330
SQEEQIARKEEELSRVKERVVQQEVVRYEEEPGLRAEASAFAESIDVELRQIDKLRAELRRLQRRRTELE   1331 - 1400
RQLEELERERQARREAEREVQRLQQRLAALEQEEAEAREKVTHTQKVVLQQDPQQAREHALLRLQLEEEQ   1401 - 1470
HRRQLLEGELETLRRKLAALEKAEVKEKVVLSESVQVEKGDTEQEIQRLKSSLEEESRSKRELDVEVSRL   1471 - 1540
EARLSELEFHNSKSSKELDFLREENHKLQLERQNLQLETRRLQSEINMAATETRDLRNMTVADSGTNHDS   1541 - 1610
RLWSLERELDDLKRLSKDKDLEIDELQKRLGSVAVKREQRENHLRRSIVVIHPDTGRELSPEEAHRAGLI   1611 - 1680
DWNMFVKLRSQECDWEEISVKGPNGESSVIHDRKSGKKFSIEEALQSGRLTPAQYDRYVNKDMSIQELAV   1681 - 1750
LVSGQK                                                                   1751 - 1756
//

Text Mined References (45)

PMID Year Title
25637025 2015 Activation of human ?? T cells by cytosolic interactions of BTN3A1 with soluble phosphoantigens and the cytoskeletal adaptor periplakin.
25520130 2014 Serum periplakin as a potential biomarker for urothelial carcinoma of the urinary bladder.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25416956 2014 A proteome-scale map of the human interactome network.
24942859 2014 Loss of periplakin expression is associated with pathological stage and cancer-specific survival in patients with urothelial carcinoma of the urinary bladder.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23319000 2014 Genome-wide association study of monoamine metabolite levels in human cerebrospinal fluid.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22841549 2012 Annexin A9 is a periplakin interacting partner in membrane-targeted cytoskeletal linker protein complexes.
22637743 2012 Genome-wide gene-environment interaction analysis for asbestos exposure in lung cancer susceptibility.
More...