Property Summary

Ligand Count 25
NCBI Gene PubMed Count 158
PubMed Score 445.31
PubTator Score 168.23

Knowledge Summary

Patent

No data available

Expression

Protein-protein Interaction (3)

Gene RIF (130)

AA Sequence

MAPDPVAAETAAQGPTPRYFTWDEVAQRSGCEERWLVIDRKVYNISEFTRRHPGGSRVISHYAGQDATDP      1 - 70
FVAFHINKGLVKKYMNSLLIGELSPEQPSFEPTKNKELTDEFRELRATVERMGLMKANHVFFLLYLLHIL     71 - 140
LLDGAAWLTLWVFGTSFLPFLLCAVLLSAVQAQAGWLQHDFGHLSVFSTSKWNHLLHHFVIGHLKGAPAS    141 - 210
WWNHMHFQHHAKPNCFRKDPDINMHPFFFALGKILSVELGKQKKKYMPYNHQHKYFFLIGPPALLPLYFQ    211 - 280
WYIFYFVIQRKKWVDLAWMITFYVRFFLTYVPLLGLKAFLGLFFIVRFLESNWFVWVTQMNHIPMHIDHD    281 - 350
RNMDWVSTQLQATCNVHKSAFNDWFSGHLNFQIEHHLFPTMPRHNYHKVAPLVQSLCAKHGIEYQSKPLL    351 - 420
SAFADIIHSLKESGQLWLDAYLHQ                                                  421 - 444
//

Text Mined References (163)

PMID Year Title