Property Summary

NCBI Gene PubMed Count 141
Grant Count 42
R01 Count 14
Funding $6,011,205.39
PubMed Score 416.69
PubTator Score 168.23

Knowledge Summary

Patent

No data available

Expression

Gene RIF (113)

PMID Text
27004414 Single nucleotide polymorphisms in FADS gene (particularly rs174537) associate with plasma fatty acids and desaturase levels in patients with both type 2 diabetes and coronary artery disease.
26633493 polymorphisms in the FADS gene cluster were nominally associated with reduced risk of developing atopic eczema
26513616 No associations were observed between any single-nucleotide polymorphisms and major depressive disorder diagnosis or attempted suicide status.
26501394 FADS1 variants modulate the relationship between marine fatty acid intake and circulating levels of long-chain omega-3 fatty acids.
26474818 genetic association study in population of pregnant women in Republic of Seychelles: SNPs in FADS1/FADS2 are associated with maternal arachidonic acid status; a subtle association exists with neurodevelopment in this high fish-eating population. [REVIEW]
26283408 genome-wide association study in population of mother/infant dyads in Denmark: Data suggest SNPs in maternal FADS1 are associated with (1) lower breast milk polyunsaturated fatty acid and (2) higher production of interleukins by infant T-lymphocytes.
26261632 Suggest that the FADS1 rs174546 SNP and the FADS2 rs174601 SNP are associated with the risk of coronary artery disease and ischemic stroke, and are likely to influence serum lipid levels.
26163647 Decreased Expression of FADS1 is associated with Esophageal Squamous Cell Carcinoma.
25981324 In northern Han Chinese people, the minor allele (T) of rs174616 in the FADS1-FADS2 gene cluster is associated with a decreased conversion rate of Linoleic acid to Arachidonic acid, which may contribute to decreased reduced risk of developing T2 diabetes.
25849351 High dietary n-3 LCPUFA intakes could negate the unfavorable effect of genetic variation in FADS1 on CAD in middle-aged and elderly Chinese population.
More...

AA Sequence

MAPDPVAAETAAQGPTPRYFTWDEVAQRSGCEERWLVIDRKVYNISEFTRRHPGGSRVISHYAGQDATDP      1 - 70
FVAFHINKGLVKKYMNSLLIGELSPEQPSFEPTKNKELTDEFRELRATVERMGLMKANHVFFLLYLLHIL     71 - 140
LLDGAAWLTLWVFGTSFLPFLLCAVLLSAVQAQAGWLQHDFGHLSVFSTSKWNHLLHHFVIGHLKGAPAS    141 - 210
WWNHMHFQHHAKPNCFRKDPDINMHPFFFALGKILSVELGKQKKKYMPYNHQHKYFFLIGPPALLPLYFQ    211 - 280
WYIFYFVIQRKKWVDLAWMITFYVRFFLTYVPLLGLKAFLGLFFIVRFLESNWFVWVTQMNHIPMHIDHD    281 - 350
RNMDWVSTQLQATCNVHKSAFNDWFSGHLNFQIEHHLFPTMPRHNYHKVAPLVQSLCAKHGIEYQSKPLL    351 - 420
SAFADIIHSLKESGQLWLDAYLHQ                                                  421 - 444
//

Text Mined References (145)

PMID Year Title
27004414 2016 Polymorphisms in FADS1 and FADS2 alter plasma fatty acids and desaturase levels in type 2 diabetic patients with coronary artery disease.
26633493 2015 Single Nucleotide Polymorphisms in the FADS Gene Cluster but not the ELOVL2 Gene are Associated with Serum Polyunsaturated Fatty Acid Composition and Development of Allergy (in a Swedish Birth Cohort).
26513616 2016 Lack of association of SNPs from the FADS1-FADS2 gene cluster with major depression or suicidal behavior.
26501394 2016 Gene-diet interaction of a common FADS1 variant with marine polyunsaturated fatty acids for fatty acid composition in plasma and erythrocytes among men.
26474818 2015 Genetic variation in FADS genes is associated with maternal long-chain PUFA status but not with cognitive development of infants in a high fish-eating observational study.
26283408 2015 Maternal fatty acid desaturase genotype correlates with infant immune responses at 6 months.
26261632 2015 Association of two polymorphisms in the FADS1/FADS2 gene cluster and the risk of coronary artery disease and ischemic stroke.
26163647 2015 Decreased Expression of FADS1 Predicts a Poor Prognosis in Patients with Esophageal Squamous Cell Carcinoma.
25981324 2015 Polymorphisms of rs174616 in the FADS1-FADS2 gene cluster is associated with a reduced risk of type 2 diabetes mellitus in northern Han Chinese people.
25849351 2015 Dietary n-3 polyunsaturated fatty acid intakes modify the effect of genetic variation in fatty acid desaturase 1 on coronary artery disease.
More...