Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.25
PubTator Score 0.50

Knowledge Summary

Patent (862)

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8520 1.3e-09
osteosarcoma 7950 4.4e-05

Gene RIF (1)

AA Sequence

MERGNQTEVGNFLLLGFAEDSDMQLLLHGLFLSMYLVTIIGNLLIILTISSDSHLHTPMYFFLSNLSFAD      1 - 70
ICFTSTTVPKMLVNIQTQSKMITFAGCLTQIFFFIAFGCLDNLLLTMTAYDRFVAICYPLHYTVIMNPRL     71 - 140
CGLLVLGSWCISVMGSLLETLTILRLSFCTNMEIPHFFCDPSEVLKLACSDTFINNIVMYFVTIVLGVFP    141 - 210
LCGILFSYSQIFSSVLRVSARGQHKAFSTCGSHLSVVSLFYGTGLGVYLSSAVTPPSRTSLAASVMYTMV    211 - 280
TPMLNPFIYSLRNKDMKGSLGRLLLRATSLKEGTIAKLS                                   281 - 319
//

Text Mined References (6)

PMID Year Title