Property Summary

NCBI Gene PubMed Count 2
PubMed Score 14.73
PubTator Score 0.33

Knowledge Summary

Patent

No data available

TINX Plot

Synonym

Accession O60397
Symbols COX7A3
COX7AL
COX7AL2
COX7AP2

Gene

PANTHER Protein Class (2)

AA Sequence

MLWNLLALHQIGQRTISTASHRHFKNKVPEKQKLFQEDDGIPLYLKGGIADALLHRATMILTVGGTAYAI      1 - 70
YQLAVASFPNKGVTSIIPAITWFTFIQLSMDQKSDK                                       71 - 106
//

Text Mined References (2)

PMID Year Title
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
1327965 1992 Tissue-specific expression and chromosome assignment of genes specifying two isoforms of subunit VIIa of human cytochrome c oxidase.