Property Summary

NCBI Gene PubMed Count 2
PubMed Score 16.51
PubTator Score 0.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
astrocytoma 1146 1.3e-03
breast carcinoma 1638 2.4e-03
osteosarcoma 7950 1.2e-02
Disease Target Count Z-score Confidence
Barrett's adenocarcinoma 2 3.483 1.7

Synonym

Accession O60397
Symbols COX7A3
COX7AL
COX7AL2
COX7AP2

Gene

PANTHER Protein Class (2)

AA Sequence

MLWNLLALHQIGQRTISTASHRHFKNKVPEKQKLFQEDDGIPLYLKGGIADALLHRATMILTVGGTAYAI      1 - 70
YQLAVASFPNKGVTSIIPAITWFTFIQLSMDQKSDK                                       71 - 106
//

Text Mined References (2)

PMID Year Title