Property Summary

NCBI Gene PubMed Count 87
PubMed Score 304.75
PubTator Score 139.28

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer 1.200 1.9e-07

Protein-protein Interaction (10)

Gene RIF (66)

AA Sequence

MARPNKFLLWFCCFAWLCFPISLGSQASGGEAQIAASAELESGAMPWSLLQHIDERDRAGLLPALFKVLS      1 - 70
VGRGGSPRLQPDSRALHYMKKLYKTYATKEGIPKSNRSHLYNTVRLFTPCTRHKQAPGDQVTGILPSVEL     71 - 140
LFNLDRITTVEHLLKSVLLYNINNSVSFSSAVKCVCNLMIKEPKSSSRTLGRAPYSFTFNSQFEFGKKHK    141 - 210
WIQIDVTSLLQPLVASNKRSIHMSINFTCMKDQLEHPSAQNGLFNMTLVSPSLILYLNDTSAQAYHSWYS    211 - 280
LHYKRRPSQGPDQERSLSAYPVGEEAAEDGRSSHHRHRRGQETVSSELKKPLGPASFNLSEYFRQFLLPQ    281 - 350
NECELHDFRLSFSQLKWDNWIVAPHRYNPRYCKGDCPRAVGHRYGSPVHTMVQNIIYEKLDSSVPRPSCV    351 - 420
PAKYSPLSVLTIEPDGSIAYKEYEDMIATKCTCR                                        421 - 454
//

Text Mined References (87)

PMID Year Title