Property Summary

NCBI Gene PubMed Count 83
Grant Count 106
R01 Count 46
Funding $9,778,602.75
PubMed Score 270.16
PubTator Score 139.28

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer 1.200 0.000

Synonym

Accession O60383 Q4VAW5 GDF-9
Symbols

Gene

PANTHER Protein Class (2)

Gene RIF (62)

PMID Text
26254468 results support a model of activation for human GDF9 dependent on cumulin formation through heterodimerization with BMP15. Oocyte-secreted cumulin is likely to be a central regulator of fertility in mono-ovular mammals.
25954833 GDF9 c.169G>T (D57Y), c.546G>A (rs1049127), and BMP15 rs79377927 (788_789insTCT) were associated with premature ovarian failure in the Chinese Hui population.
25368253 Reduced expression of growth and differentiation factor-9 is associated with aggressive behaviour of clear-cell renal cell carcinoma.
25253739 The arginine residue in the pre-helix loop of GDF9 homodimer may prevent the inhibition from its pro-domain or directly alter receptor binding, but this residue in GDF9 does not significantly affect the heterodimer activity.
25172094 GDF9 and BMP15 expression is reduced in primordial, primary, and secondary follicles in ovarian tissues of PCOS patients.
25139161 Data suggest up-regulation of mRNA for GDF9 and BMP15 (bone morphogenetic protein 15) in cumulus granulosa cells serves as biomarker for oocyte maturation, fertilization, embryo quality, and pregnancy in couples undergoing ICSI for male infertility.
24939957 Eleven unique copy number changes are identified in a total of 11 patients, including a tandem duplication of 475 bp, containing part of the GDF9 gene promoter region.
24840335 These results suggest that COCs cultured with recombinant GDF9 in oocyte maturation medium improve oocyte developmental competence and subsequent developmental competence of cloned embryo in cattle.
24438375 Alterations to hGDF9 synthesis and activity can contribute to the most common ovarian pathologies.
24430093 GDF-9 and GDF-15 levels may influence bone parameters in polycystic ovary syndrome
More...

AA Sequence

MARPNKFLLWFCCFAWLCFPISLGSQASGGEAQIAASAELESGAMPWSLLQHIDERDRAGLLPALFKVLS      1 - 70
VGRGGSPRLQPDSRALHYMKKLYKTYATKEGIPKSNRSHLYNTVRLFTPCTRHKQAPGDQVTGILPSVEL     71 - 140
LFNLDRITTVEHLLKSVLLYNINNSVSFSSAVKCVCNLMIKEPKSSSRTLGRAPYSFTFNSQFEFGKKHK    141 - 210
WIQIDVTSLLQPLVASNKRSIHMSINFTCMKDQLEHPSAQNGLFNMTLVSPSLILYLNDTSAQAYHSWYS    211 - 280
LHYKRRPSQGPDQERSLSAYPVGEEAAEDGRSSHHRHRRGQETVSSELKKPLGPASFNLSEYFRQFLLPQ    281 - 350
NECELHDFRLSFSQLKWDNWIVAPHRYNPRYCKGDCPRAVGHRYGSPVHTMVQNIIYEKLDSSVPRPSCV    351 - 420
PAKYSPLSVLTIEPDGSIAYKEYEDMIATKCTCR                                        421 - 454
//

Text Mined References (83)

PMID Year Title
26254468 2015 Cumulin, an Oocyte-secreted Heterodimer of the Transforming Growth Factor-? Family, Is a Potent Activator of Granulosa Cells and Improves Oocyte Quality.
25954833 2015 Single nucleotide polymorphisms in premature ovarian failure-associated genes in a Chinese Hui population.
25368253 2014 Reduced expression of growth and differentiation factor-9 (GDF9) is associated with aggressive behaviour of human clear-cell renal cell carcinoma and poor patient survival.
25253739 2014 Amino acid 72 of mouse and human GDF9 mature domain is responsible for altered homodimer bioactivities but has subtle effects on GDF9:BMP15 heterodimer activities.
25172094 2014 Reduced and delayed expression of GDF9 and BMP15 in ovarian tissues from women with polycystic ovary syndrome.
25139161 2014 Increased GDF9 and BMP15 mRNA levels in cumulus granulosa cells correlate with oocyte maturation, fertilization, and embryo quality in humans.
24939957 2014 Identification of a duplication within the GDF9 gene and novel candidate genes for primary ovarian insufficiency (POI) by a customized high-resolution array comparative genomic hybridization platform.
24840335 2014 Recombinant human growth differentiation factor-9 improves oocyte reprogramming competence and subsequent development of bovine cloned embryos.
24438375 2014 Aberrant GDF9 expression and activation are associated with common human ovarian disorders.
24430093 2015 Association of plasma GDF-9 or GDF-15 levels with bone parameters in polycystic ovary syndrome.
More...