Property Summary

NCBI Gene PubMed Count 40
PubMed Score 13.42
PubTator Score 52.06

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
aldosterone-producing adenoma -1.003 3.1e-02
Gaucher disease type 3 -1.200 4.6e-03
group 3 medulloblastoma 1.100 1.4e-02
intraductal papillary-mucinous adenoma (... 1.300 1.0e-02
intraductal papillary-mucinous carcinoma... 1.400 8.5e-04
lung cancer -1.200 3.2e-03
ovarian cancer -1.500 1.3e-07
psoriasis -1.300 3.5e-04
Rheumatoid arthritis 2.200 7.8e-03
tuberculosis and treatment for 6 months 1.100 1.7e-04

Gene RIF (29)

AA Sequence

MVWEVKTNQMPNAVQKLLLVMDKRASGMNDSLELLQCNENLPSSPGYNSCDEHMELDDLPELQAVQSDPT      1 - 70
QSGMYQLSSDVSHQEYPRSSWNQNTSDIPETTYRENEVDWLTELANIATSPQSPLMQCSFYNRSSPVHII     71 - 140
ATSKSLHSYARPPPVSSSSKSEPAFPHHHWKEETPVRHERANSESESGIFCMSSLSDDDDLGWCNSWPST    141 - 210
VWHCFLKGTRLCFHKGSNKEWQDVEDFARAEGCDNEEDLQMGIHKGYGSDGLKLLSHEESVSFGESVLKL    211 - 280
TFDPGTVEDGLLTVECKLDHPFYVKNKGWSSFYPSLTVVQHGIPCCEVHIGDVCLPPGHPDAINFDDSGV    281 - 350
FDTFKSYDFTPMDSSAVYVLSSMARQRRASLSCGGPGGQDFARSGFSKNCGSPGSSQLSSNSLYAKAVKN    351 - 420
HSSGTVSATSPNKCKRPMNAFMLFAKKYRVEYTQMYPGKDNRAISVILGDRWKKMKNEERRMYTLEAKAL    421 - 490
AEEQKRLNPDCWKRKRTNSGSQQH                                                  491 - 514
//

Text Mined References (43)

PMID Year Title