Property Summary

NCBI Gene PubMed Count 35
Grant Count 20
R01 Count 11
Funding $2,179,276.71
PubMed Score 11.07
PubTator Score 52.06

Knowledge Summary

Patent

No data available

Expression

Gene RIF (24)

PMID Text
26660958 All trans-retinoic acid can reverse the suppressive effect of MED28 on HBP1 and E-cadherin and inactivate the Wnt/beta-catenin pathway in colorectal cancer, suggesting a protective effect of ATRA against colorectal cancer.
26041766 Hbp1 plays a crucial role in regulating the timing of cortical neurogenesis by elongating the cell cycle and that it is essential for normal cortical development.
25666090 HBP1-mediated Wnt signaling is involved with the role of miR-155 in osteosarcoma progression.
24931370 miR-96/HBP1/Wnt/beta-catenin regulatory circuitry promotes the proliferation of glioma cell
24895061 HBP1 is a suppressor of cancer progression and a regulator of CTNNB1 gene transcription.
24762137 HBP1 is a novel target of the PI3K/FOXO pathway and controls cell proliferation in response to growth factors.
23613959 acetylation of TCF4E is a novel regulatory mechanism that diversifies the transcriptional output of Wnt/beta-catenin signaling
23249948 HBP1 represses the DNMT1 gene through binding a high-affinity site in the DNMT1 promoter.
22586168 Cis-acting regulatory polymorphisms acting on HBP1 contribute to the osteoarthritis association signal at chromosome 7q22.
20581871 HBP1 targets P16(INK4A), upregulating its expression and consequently is involved in Ras-induced premature senescence.
More...

AA Sequence

MVWEVKTNQMPNAVQKLLLVMDKRASGMNDSLELLQCNENLPSSPGYNSCDEHMELDDLPELQAVQSDPT      1 - 70
QSGMYQLSSDVSHQEYPRSSWNQNTSDIPETTYRENEVDWLTELANIATSPQSPLMQCSFYNRSSPVHII     71 - 140
ATSKSLHSYARPPPVSSSSKSEPAFPHHHWKEETPVRHERANSESESGIFCMSSLSDDDDLGWCNSWPST    141 - 210
VWHCFLKGTRLCFHKGSNKEWQDVEDFARAEGCDNEEDLQMGIHKGYGSDGLKLLSHEESVSFGESVLKL    211 - 280
TFDPGTVEDGLLTVECKLDHPFYVKNKGWSSFYPSLTVVQHGIPCCEVHIGDVCLPPGHPDAINFDDSGV    281 - 350
FDTFKSYDFTPMDSSAVYVLSSMARQRRASLSCGGPGGQDFARSGFSKNCGSPGSSQLSSNSLYAKAVKN    351 - 420
HSSGTVSATSPNKCKRPMNAFMLFAKKYRVEYTQMYPGKDNRAISVILGDRWKKMKNEERRMYTLEAKAL    421 - 490
AEEQKRLNPDCWKRKRTNSGSQQH                                                  491 - 514
//

Text Mined References (38)

PMID Year Title
26660958 2016 All Trans-Retinoic Acid Mediates MED28/HMG Box-Containing Protein 1 (HBP1)/?-Catenin Signaling in Human Colorectal Cancer Cells.
26041766 2015 Hbp1 regulates the timing of neuronal differentiation during cortical development by controlling cell cycle progression.
25666090 2015 miR-155 promotes the growth of osteosarcoma in a HBP1-dependent mechanism.
24931370 2014 miR-96/HBP1/Wnt/?-catenin regulatory circuitry promotes glioma growth.
24895061 2014 HBP1 promoter methylation augments the oncogenic ?-catenin to correlate with prognosis in NSCLC.
24762137 2014 The expression of the tumour suppressor HBP1 is down-regulated by growth factors via the PI3K/PKB/FOXO pathway.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23859194 2013 Mitogen-activated protein kinase p38 and retinoblastoma protein signalling is required for DNA damage-mediated formation of senescence-associated heterochromatic foci in tumour cells.
23613959 2013 Acetylation of human TCF4 (TCF7L2) proteins attenuates inhibition by the HBP1 repressor and induces a conformational change in the TCF4::DNA complex.
23249948 2013 HBP1-mediated transcriptional regulation of DNA methyltransferase 1 and its impact on cell senescence.
More...