Property Summary

NCBI Gene PubMed Count 4
PubMed Score 1033.03

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
diabetes mellitus 1728 1.5e-03
Disease Target Count Z-score Confidence
interstitial cystitis 2312 5.764 2.9
Pain disorder 15 4.204 2.1
Cancer 2499 4.036 2.0

AA Sequence

MQCGLVGKIIKRFEQKGFRLVAMKFLPASEEHLKQHYIDLKDRPFFPGLVKYMNSGPVVAMVWEGLNVVK      1 - 70
TGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVKSAEKEISLRFKPEELVDYKSCAHDWVYE        71 - 137
//

Text Mined References (5)

PMID Year Title