Property Summary

NCBI Gene PubMed Count 4
PubMed Score 972.83

Knowledge Summary

Patent

No data available

TINX Plot

Synonym

Accession O60361 NDK
Symbols

Gene

AA Sequence

MQCGLVGKIIKRFEQKGFRLVAMKFLPASEEHLKQHYIDLKDRPFFPGLVKYMNSGPVVAMVWEGLNVVK      1 - 70
TGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVKSAEKEISLRFKPEELVDYKSCAHDWVYE        71 - 137
//

Text Mined References (5)

PMID Year Title
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
21630459 2011 Proteomic characterization of the human sperm nucleus.
16541075 2006 The finished DNA sequence of human chromosome 12.
8270257 1994 Isolation and characterization of the human genomic locus coding for the putative metastasis control gene nm23-H1.
7488060 1995 Characterization of the human nm23-H2 promoter region and localization of the microsatellite D17S396.