Property Summary

NCBI Gene PubMed Count 14
PubMed Score 2.58
PubTator Score 4.35

Knowledge Summary

Patent (655)

Expression

  Differential Expression (12)

Disease log2 FC p
adult high grade glioma -2.900 1.5e-03
astrocytic glioma -2.700 1.3e-03
Astrocytoma, Pilocytic -3.400 1.6e-07
atypical teratoid / rhabdoid tumor -3.500 5.1e-10
ependymoma -3.300 4.9e-04
glioblastoma -3.200 5.0e-10
group 4 medulloblastoma -2.600 2.7e-03
medulloblastoma, large-cell -2.600 3.5e-03
oligodendroglioma -2.400 5.2e-03
Pick disease -1.400 1.6e-02
primitive neuroectodermal tumor -3.100 8.1e-05
severe Alzheimer's disease -1.369 1.4e-02

Protein-protein Interaction (5)

Gene RIF (4)

AA Sequence

MRMCDRGIQMLITTVGAFAAFSLMTIAVGTDYWLYSRGVCRTKSTSDNETSRKNEEVMTHSGLWRTCCLE      1 - 70
GAFRGVCKKIDHFPEDADYEQDTAEYLLRAVRASSVFPILSVTLLFFGGLCVAASEFHRSRHNVILSAGI     71 - 140
FFVSAGLSNIIGIIVYISANAGDPGQRDSKKSYSYGWSFYFGAFSFIIAEIVGVVAVHIYIEKHQQLRAK    141 - 210
SHSEFLKKSTFARLPPYRYRFRRRSSSRSTEPRSRDLSPISKGFHTIPSTDISMFTLSRDPSKITMGTLL    211 - 280
NSDRDHAFLQFHNSTPKEFKESLHNNPANRRTTPV                                       281 - 315
//

Text Mined References (14)

PMID Year Title