Property Summary

NCBI Gene PubMed Count 30
Grant Count 1
R01 Count 1
Funding $182,887
PubMed Score 38.18
PubTator Score 24.98

Knowledge Summary

Patent (7,982)

Expression

  Differential Expression (13)

Synonym

Accession O60353 B4DRN0 Q6N0A5 Q6P9C3 Q8WXR9 Fz-6
Symbols FZ6
FZ-6
HFZ6
NDNC10

Gene

 Grant Application (1)

Gene RIF (18)

PMID Text
25772759 we found that FZD6 expression was negatively regulated by miR199a5p
24816679 The rs3808553 of FZD6 is obviously associated with neural tube defects in Han population of northern China
24657404 This study confirms our speculation that down-regulation of FZD6 by beta-Carotene is causally related to the observed up-regulation of cancer related genes
24500924 DVL is a master regulator of FZD6/G-protein signaling
23748645 It is associated with poor prognosis in glioblastoma patients.
23374899 FZD6 should be screened for pachyonychia congenita as it is a candidate gene for hereditary nail dysplasias.
22861124 sequence analysis revealed a novel homozygous missense mutation (c.1266G>A; p.Gly422Asp) located in the transmembrane domain of the protein FZD6 in individuals of a consanguineous family exhibiting features of nail dysplasia
22249030 When transplanted into immunodeficient mice, neuroblastoma cells expressing the Fzd6 marker grow more aggressively than their Fzd6 negative counterparts. Fzd6 is a new surface marker of aggressive neuroblastoma cells with stem cell-like features.
22211385 The present results emphasize the role of FZD6 mutation in Wnt pathways in nail development.
22078044 Mutations in this gene cause nail dysplasia. Review.
More...

AA Sequence

MEMFTFLLTCIFLPLLRGHSLFTCEPITVPRCMKMAYNMTFFPNLMGHYDQSIAAVEMEHFLPLANLECS      1 - 70
PNIETFLCKAFVPTCIEQIHVVPPCRKLCEKVYSDCKKLIDTFGIRWPEELECDRLQYCDETVPVTFDPH     71 - 140
TEFLGPQKKTEQVQRDIGFWCPRHLKTSGGQGYKFLGIDQCAPPCPNMYFKSDELEFAKSFIGTVSIFCL    141 - 210
CATLFTFLTFLIDVRRFRYPERPIIYYSVCYSIVSLMYFIGFLLGDSTACNKADEKLELGDTVVLGSQNK    211 - 280
ACTVLFMLLYFFTMAGTVWWVILTITWFLAAGRKWSCEAIEQKAVWFHAVAWGTPGFLTVMLLAMNKVEG    281 - 350
DNISGVCFVGLYDLDASRYFVLLPLCLCVFVGLSLLLAGIISLNHVRQVIQHDGRNQEKLKKFMIRIGVF    351 - 420
SGLYLVPLVTLLGCYVYEQVNRITWEITWVSDHCRQYHIPCPYQAKAKARPELALFMIKYLMTLIVGISA    421 - 490
VFWVGSKKTCTEWAGFFKRNRKRDPISESRRVLQESCEFFLKHNSKVKHKKKHYKPSSHKLKVISKSMGT    491 - 560
STGATANHGTSAVAITSHDYLGQETLTEIQTSPETSMREVKADGASTPRLREQDCGEPASPAASISRLSG    561 - 630
EQVDGKGQAGSVSESARSEGRISPKSDITDTGLAQSNNLQVPSSSEPSSLKGSTSLLVHPVSGVRKEQGG    631 - 700
GCHSDT                                                                    701 - 706
//

Text Mined References (35)

PMID Year Title
25772759 2015 FZD6 expression is negatively regulated by miR-199a-5p in human colorectal cancer.
24816679 2014 Polymorphisms in FZD3 and FZD6 genes and risk of neural tube defects in a northern Han Chinese population.
24657404 2014 Role of Frizzled6 in the molecular mechanism of beta-carotene action in the lung.
24500924 2014 Disheveled regulates precoupling of heterotrimeric G proteins to Frizzled 6.
24431302 2014 Wnt signaling in midbrain dopaminergic neuron development and regenerative medicine for Parkinson's disease.
23748645 2014 Immunoreactivity of Wnt5a, Fzd2, Fzd6, and Ryk in glioblastoma: evaluative methodology for DAB chromogenic immunostaining.
23374899 2013 Recessive mutations in the gene encoding frizzled 6 cause twenty nail dystrophy--expanding the differential diagnosis for pachyonychia congenita.
22861124 2013 A novel missense mutation in the gene FZD6 underlies autosomal recessive nail dysplasia.
22575959 2012 ZNRF3 promotes Wnt receptor turnover in an R-spondin-sensitive manner.
22249030 2011 Frizzled receptor 6 marks rare, highly tumourigenic stem-like cells in mouse and human neuroblastomas.
More...