Property Summary

NCBI Gene PubMed Count 34
PubMed Score 44.46
PubTator Score 24.98

Knowledge Summary

Patent (7,982)

Expression

  Differential Expression (13)

Disease log2 FC p
acute myeloid leukemia -1.200 4.6e-02
adult high grade glioma 1.400 1.3e-02
aldosterone-producing adenoma -1.573 3.7e-02
Astrocytoma, Pilocytic 2.700 1.8e-08
atypical teratoid / rhabdoid tumor 1.600 3.0e-02
ependymoma 3.100 8.3e-18
glioblastoma 2.300 2.7e-06
group 3 medulloblastoma 1.900 3.5e-03
malignant mesothelioma -1.100 2.9e-04
osteosarcoma 2.950 3.1e-04
ovarian cancer 1.100 2.3e-02
primitive neuroectodermal tumor 1.500 9.2e-03
psoriasis 2.600 1.4e-04

Gene RIF (22)

AA Sequence

MEMFTFLLTCIFLPLLRGHSLFTCEPITVPRCMKMAYNMTFFPNLMGHYDQSIAAVEMEHFLPLANLECS      1 - 70
PNIETFLCKAFVPTCIEQIHVVPPCRKLCEKVYSDCKKLIDTFGIRWPEELECDRLQYCDETVPVTFDPH     71 - 140
TEFLGPQKKTEQVQRDIGFWCPRHLKTSGGQGYKFLGIDQCAPPCPNMYFKSDELEFAKSFIGTVSIFCL    141 - 210
CATLFTFLTFLIDVRRFRYPERPIIYYSVCYSIVSLMYFIGFLLGDSTACNKADEKLELGDTVVLGSQNK    211 - 280
ACTVLFMLLYFFTMAGTVWWVILTITWFLAAGRKWSCEAIEQKAVWFHAVAWGTPGFLTVMLLAMNKVEG    281 - 350
DNISGVCFVGLYDLDASRYFVLLPLCLCVFVGLSLLLAGIISLNHVRQVIQHDGRNQEKLKKFMIRIGVF    351 - 420
SGLYLVPLVTLLGCYVYEQVNRITWEITWVSDHCRQYHIPCPYQAKAKARPELALFMIKYLMTLIVGISA    421 - 490
VFWVGSKKTCTEWAGFFKRNRKRDPISESRRVLQESCEFFLKHNSKVKHKKKHYKPSSHKLKVISKSMGT    491 - 560
STGATANHGTSAVAITSHDYLGQETLTEIQTSPETSMREVKADGASTPRLREQDCGEPASPAASISRLSG    561 - 630
EQVDGKGQAGSVSESARSEGRISPKSDITDTGLAQSNNLQVPSSSEPSSLKGSTSLLVHPVSGVRKEQGG    631 - 700
GCHSDT                                                                    701 - 706
//

Text Mined References (39)

PMID Year Title