Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.37
PubTator Score 0.06

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8520 4.7e-07
malignant mesothelioma 3232 1.7e-06
tuberculosis 2010 2.9e-06
psoriasis 6694 2.6e-04
medulloblastoma, large-cell 6241 8.1e-03
osteosarcoma 7950 9.5e-03
lung cancer 4740 1.2e-02
Breast cancer 3578 4.8e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7

Expression

  Differential Expression (8)

Disease log2 FC p
Breast cancer 2.400 4.8e-02
lung cancer 1.200 1.2e-02
malignant mesothelioma 1.500 1.7e-06
medulloblastoma, large-cell -1.200 8.1e-03
osteosarcoma 1.527 9.5e-03
ovarian cancer -1.800 4.7e-07
psoriasis 2.500 2.6e-04
tuberculosis -1.600 2.9e-06

AA Sequence

MVGPEDAGACSGRNPKLLPVPAPDPVGQDRKVIRATGGFGGGVGAVEPPEEADEEEEADEEEETPPRQLL      1 - 70
QRYLAAAGEQLEPGLCYCPLPAGQAGAPPPSAAPRSDACLLGSGSKHRGAEVADGRAPRHEGMTNGDSGF     71 - 140
LPGRDCRDLEEARGLARAGGRESRRRRPYGRLRLEGPGDEDADGAGSPSDWASPLEDPLRSCCLVAADAQ    141 - 210
EPEGAGSDSGDSPASSCSSSEDSEQRGVGAGGPEEGAPPATSAERTNGGAEPRLGFSDIHFNSRNTFQVS    211 - 280
RGQSARDHLPPAGPPVPLPAAEQGPAGASARARRSGGFADFFTRNLFPKRTKELKSVVHSAPGWKLFGKV    281 - 350
PPRENLQKTSKIIQQEYEARTGRTCKPPPQSSRRKNFEFEPLSTTALILEDRPSNLPAKSVEEALRHRQE    351 - 420
YDEMVAEAKKREIKEAHKRKRIMKERFKQEENIASAMVIWINEILPNWEVMRSTRRVRELWWQGLPPSVR    421 - 490
GKVWSLAVGNELNITPELYEIFLSRAKERWKSFSETSSENDTEGVSVADREASLELIKLDISRTFPSLYI    491 - 560
FQKGGPYHDVLHSILGAYTCYRPDVGYVQGMSFIAAVLILNLEEADAFIAFANLLNKPCQLAFFRVDHSM    561 - 630
MLKYFATFEVFFEENLSKLFLHFKSYSLTPDIYLIDWIFTLYSKSLPLDLACRVWDVFCRDGEEFLFRTG    631 - 700
LGILRLYEDILLQMDFIHIAQFLTKLPEDITSEKLFSCIAAIQMQNSTKKWTQVFASVMKDIKEGDKNSS    701 - 770
PALKS                                                                     771 - 775
//

Text Mined References (11)

PMID Year Title