Property Summary

NCBI Gene PubMed Count 58
Grant Count 55
R01 Count 38
Funding $3,833,476.59
PubMed Score 96.23
PubTator Score 100.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
psoriasis -2.900 0.000
osteosarcoma -2.973 0.000
group 3 medulloblastoma -1.600 0.000
medulloblastoma, large-cell -1.700 0.000
tuberculosis -1.100 0.000
lung cancer 1.900 0.000
interstitial cystitis -2.100 0.000
atypical teratoid/rhabdoid tumor -1.200 0.028
subependymal giant cell astrocytoma -1.974 0.040
invasive ductal carcinoma -1.182 0.007
Breast cancer -1.100 0.000
pituitary cancer -1.200 0.000
Down syndrome 1.400 0.001

Gene RIF (45)

PMID Text
26823799 our results suggest that PHLPP1 plays a crucial role in sacral chordoma
26463718 high levels of PHLPP might reflect a less aggressive lung adenocarcinoma phenotype and predict better survival in patients with lung adenocarcinoma.
26427440 Data show that both serine/threonine phosphatases PHLPP and dephosphorylated the physiological substrates of Akt1 and Akt3 with similar efficiencies.
26245343 Results showed that PHLPP1 and PHLPP2 gene expression are down-regulated in esophageal squamous cell carcinoma. Their promotor is a target for mir-224.
25793736 Aberrant expression of PHLPP1 and PHLPP2 correlates with poor prognosis in patients with hypopharyngeal squamous cell carcinoma
25776496 PHLPP1, along with miR-522, promoted tumor cell growth in glioblastoma cells.
24945731 miR-141 and its targets PHLPP1 and PHLPP2 play critical roles in NSCLC tumorigenesis
24892992 biochemical characterization of phosphatase domain of PHLPP1 and PHLPP2;PHLPP1 and PHLPP2 have similar in vitro activities and respond comparably to the presence of metallic ions; metallic ions affect structural stability of the domain;identified 3 residues likely involved in metal coordination and 2 that may be important for structural integrity
24599953 conclude that cross-talk between PTEN and PHLPPs is silenced in normal prostate cells but activated in TGF-beta1 transformed prostate stem and cancer cells and facilitates invasive growth
24393845 PHLPP1 is a binding protein for Mst1 and it modulates the Hippo pathway by dephosphorylating Mst1 at the inhibitory Thr(387) of Mst1.
More...

AA Sequence

MEPAAAATVQRLPELGREDRASAPAAAAAAAAAAAAAAAALAAAAGGGRSPEPALTPAAPSGGNGSGSGA      1 - 70
REEAPGEAPPGPLPGRAGGAGRRRRRGAPQPIAGGAAPVPGAGGGANSLLLRRGRLKRNLSAAAAAASSS     71 - 140
SSSSAAAASHSPGAAGLPASCSASASLCTRSLDRKTLLLKHRQTLQLQPSDRDWVRHQLQRGCVHVFDRH    141 - 210
MASTYLRPVLCTLDTTAGEVAARLLQLGHKGGGVVKVLGQGPGAAAAREPAEPPPEAGPRLAPPEPRDSE    211 - 280
VPPARSAPGAFGGPPRAPPADLPLPVGGPGGWSRRASPAPSDSSPGEPFVGGPVSSPRAPRPVVSDTESF    281 - 350
SLSPSAESVSDRLDPYSSGGGSSSSSEELEADAASAPTGVPGQPRRPGHPAQPLPLPQTASSPQPQQKAP    351 - 420
RAIDSPGGAVREGSCEEKAAAAVAPGGLQSTPGRSGVTAEKAPPPPPPPTLYVQLHGETTRRLEAEEKPL    421 - 490
QIQNDYLFQLGFGELWRVQEEGMDSEIGCLIRFYAGKPHSTGSSERIQLSGMYNVRKGKMQLPVNRWTRR    491 - 560
QVILCGTCLIVSSVKDSLTGKMHVLPLIGGKVEEVKKHQHCLAFSSSGPQSQTYYICFDTFTEYLRWLRQ    561 - 630
VSKVASQRISSVDLSCCSLEHLPANLFYSQDLTHLNLKQNFLRQNPSLPAARGLNELQRFTKLKSLNLSN    631 - 700
NHLGDFPLAVCSIPTLAELNVSCNALRSVPAAVGVMHNLQTFLLDGNFLQSLPAELENMKQLSYLGLSFN    701 - 770
EFTDIPEVLEKLTAVDKLCMSGNCVETLRLQALRKMPHIKHVDLRLNVIRKLIADEVDFLQHVTQLDLRD    771 - 840
NKLGDLDAMIFNNIEVLHCERNQLVTLDICGYFLKALYASSNELVQLDVYPVPNYLSYMDVSRNRLENVP    841 - 910
EWVCESRKLEVLDIGHNQICELPARLFCNSSLRKLLAGHNQLARLPERLERTSVEVLDVQHNQLLELPPN    911 - 980
LLMKADSLRFLNASANKLESLPPATLSEETNSILQELYLTNNSLTDKCVPLLTGHPHLKILHMAYNRLQS    981 - 1050
FPASKMAKLEELEEIDLSGNKLKAIPTTIMNCRRMHTVIAHSNCIEVFPEVMQLPEIKCVDLSCNELSEV   1051 - 1120
TLPENLPPKLQELDLTGNPRLVLDHKTLELLNNIRCFKIDQPSTGDASGAPAVWSHGYTEASGVKNKLCV   1121 - 1190
AALSVNNFCDNREALYGVFDGDRNVEVPYLLQCTMSDILAEELQKTKNEEEYMVNTFIVMQRKLGTAGQK   1191 - 1260
LGGAAVLCHIKHDPVDPGGSFTLTSANVGKCQTVLCRNGKPLPLSRSYIMSCEEELKRIKQHKAIITEDG   1261 - 1330
KVNGVTESTRILGYTFLHPSVVPRPHVQSVLLTPQDEFFILGSKGLWDSLSVEEAVEAVRNVPDALAAAK   1331 - 1400
KLCTLAQSYGCHDSISAVVVQLSVTEDSFCCCELSAGGAVPPPSPGIFPPSVNMVIKDRPSDGLGVPSSS   1401 - 1470
SGMASEISSELSTSEMSSEVGSTASDEPPPGALSENSPAYPSEQRCMLHPICLSNSFQRQLSSATFSSAF   1471 - 1540
SDNGLDSDDEEPIEGVFTNGSRVEVEVDIHCSRAKEKEKQQHLLQVPAEASDEGIVISANEDEPGLPRKA   1541 - 1610
DFSAVGTIGRRRANGSVAPQERSHNVIEVATDAPLRKPGGYFAAPAQPDPDDQFIIPPELEEEVKEIMKH   1611 - 1680
HQEQQQQQQPPPPPQLQPQLPRHYQLDQLPDYYDTPL                                    1681 - 1717
//

Text Mined References (63)

PMID Year Title
26823799 2015 Low expression of PHLPP1 in sacral chordoma and its association with poor prognosis.
26463718 2015 High PHLPP expression is associated with better prognosis in patients with resected lung adenocarcinoma.
26427440 2016 Photoreceptor Neuroprotection: Regulation of Akt Activation Through Serine/Threonine Phosphatases, PHLPP and PHLPPL.
26245343 2015 Expression and role of oncogenic miRNA-224 in esophageal squamous cell carcinoma.
25820252 2015 Interactome of the negative regulator of nuclear import BRCA1-binding protein 2.
25793736 2015 Aberrant expression of PHLPP1 and PHLPP2 correlates with poor prognosis in patients with hypopharyngeal squamous cell carcinoma.
25776496 2015 MiR-522 contributes to cell proliferation of human glioblastoma cells by suppressing PHLPP1 expression.
24945731 2014 MicroRNA-141 promotes the proliferation of non-small cell lung cancer cells by regulating expression of PHLPP1 and PHLPP2.
24892992 2014 Biochemical characterization of the phosphatase domain of the tumor suppressor PH domain leucine-rich repeat protein phosphatase.
24599953 2014 Phosphatase and tensin homolog deleted on chromosome 10 (PTEN) and PH domain and leucine-rich repeat phosphatase cross-talk (PHLPP) in cancer cells and in transforming growth factor ?-activated stem cells.
More...