Property Summary

NCBI Gene PubMed Count 23
Grant Count 19
R01 Count 18
Funding $3,704,046.5
PubMed Score 24.88
PubTator Score 28.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Gene RIF (8)

PMID Text
22027013 Te results of this study suggested taht genetic variations in MMEL1, ECE1, ECE2, AGER, PLG, PLAT, NR1H3, MMP3, LRP1, TTR, NR1H2, and MMP9 genes do not play major role among the Finnish AD patient cohort.
20807771 The PL405 assay is thus the first tool to study ECE-2 inhibition using high throughput screening or for ex vivo ECE-2 quantification.
19626040 Observational study of gene-disease association. (HuGE Navigator)
19541930 Abeta accumulation in Alzheimer's disease is unlikely to be caused by ECE-2 deficiency. However, ECE-2 expression is up-regulated
19089949 An intact SAM-dependent methyltransferase fold is encoded by the human endothelin-converting enzyme-2 gene
17545092 Data show that CD133 and ECE expressions are associated with lymphoid metastasis and prognosis of NSCLC, and their overexpression often suggests unfavorable prognosis of NSCLC.
17188679 The most significantly downregulated gene in this data set was the endothelin converting enzyme 2 (ECE2), implicated in amyloid beta clearance.
16567585 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MASPGAGRAPPELPERNCGYREVEYWDQRYQGAADSAPYDWFGDFSSFRALLEPELRPEDRILVLGCGNS      1 - 70
ALSYELFLGGFPNVTSVDYSSVVVAAMQARHAHVPQLRWETMDVRKLDFPSASFDVVLEKGTLDALLAGE     71 - 140
RDPWTVSSEGVHTVDQVLSEVGFQKGTRQLLGSRTQLELVLAGASLLLAALLLGCLVALGVQYHRDPSHS    141 - 210
TCLTEACIRVAGKILESLDRGVSPCEDFYQFSCGGWIRRNPLPDGRSRWNTFNSLWDQNQAILKHLLENT    211 - 280
TFNSSSEAEQKTQRFYLSCLQVERIEELGAQPLRDLIEKIGGWNITGPWDQDNFMEVLKAVAGTYRATPF    281 - 350
FTVYISADSKSSNSNVIQVDQSGLFLPSRDYYLNRTANEKVLTAYLDYMEELGMLLGGRPTSTREQMQQV    351 - 420
LELEIQLANITVPQDQRRDEEKIYHKMSISELQALAPSMDWLEFLSFLLSPLELSDSEPVVVYGMDYLQQ    421 - 490
VSELINRTEPSILNNYLIWNLVQKTTSSLDRRFESAQEKLLETLYGTKKSCVPRWQTCISNTDDALGFAL    491 - 560
GSLFVKATFDRQSKEIAEGMISEIRTAFEEALGQLVWMDEKTRQAAKEKADAIYDMIGFPDFILEPKELD    561 - 630
DVYDGYEISEDSFFQNMLNLYNFSAKVMADQLRKPPSRDQWSMTPQTVNAYYLPTKNEIVFPAGILQAPF    631 - 700
YARNHPKALNFGGIGVVMGHELTHAFDDQGREYDKEGNLRPWWQNESLAAFRNHTACMEEQYNQYQVNGE    701 - 770
RLNGRQTLGENIADNGGLKAAYNAYKAWLRKHGEEQQLPAVGLTNHQLFFVGFAQVWCSVRTPESSHEGL    771 - 840
VTDPHSPARFRVLGTLSNSRDFLRHFGCPVGSPMNPGQLCEVW                               841 - 883
//

Text Mined References (27)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
22693153 2012 The role of ECE1 variants in cognitive ability in old age and Alzheimer's disease risk.
22472876 2013 A mega-analysis of genome-wide association studies for major depressive disorder.
22027013 2012 Genetic analysis of genes involved in amyloid-? degradation and clearance in Alzheimer's disease.
21406445 2011 Expression pattern of endothelin system components and localization of smooth muscle cells in the human pre-ovulatory follicle.
21102462 2010 Thirty new loci for age at menarche identified by a meta-analysis of genome-wide association studies.
20807771 2010 Identification of an endothelin-converting enzyme-2-specific fluorigenic substrate and development of an in vitro and ex vivo enzymatic assay.
20432672 2009 [Artificial endothelial cell. From stem cells to transdifferentiated endothelial cells].
20143331 2010 Transdifferentiation potentiality of human Wharton's jelly stem cells towards vascular endothelial cells.
19626040 2009 Follow-up examination of linkage and association to chromosome 1q43 in multiple sclerosis.
More...