Property Summary

NCBI Gene PubMed Count 24
PubMed Score 26.81
PubTator Score 28.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.200 3.4e-08
Breast cancer 1.100 1.2e-07
invasive ductal carcinoma 1.100 1.1e-03
lung adenocarcinoma 1.400 3.3e-08
medulloblastoma, large-cell 2.100 1.9e-04
non-small cell lung cancer 2.290 2.0e-24
osteosarcoma 1.078 2.4e-04
ovarian cancer 1.400 8.7e-09
pancreatic cancer -1.200 2.9e-04
pancreatic ductal adenocarcinoma liver m... -1.361 2.6e-03
pituitary cancer 1.700 3.6e-05
posterior fossa group A ependymoma -1.100 3.4e-11
psoriasis 1.300 3.7e-45

Protein-protein Interaction (5)

Gene RIF (9)

AA Sequence

MASPGAGRAPPELPERNCGYREVEYWDQRYQGAADSAPYDWFGDFSSFRALLEPELRPEDRILVLGCGNS      1 - 70
ALSYELFLGGFPNVTSVDYSSVVVAAMQARHAHVPQLRWETMDVRKLDFPSASFDVVLEKGTLDALLAGE     71 - 140
RDPWTVSSEGVHTVDQVLSEVGFQKGTRQLLGSRTQLELVLAGASLLLAALLLGCLVALGVQYHRDPSHS    141 - 210
TCLTEACIRVAGKILESLDRGVSPCEDFYQFSCGGWIRRNPLPDGRSRWNTFNSLWDQNQAILKHLLENT    211 - 280
TFNSSSEAEQKTQRFYLSCLQVERIEELGAQPLRDLIEKIGGWNITGPWDQDNFMEVLKAVAGTYRATPF    281 - 350
FTVYISADSKSSNSNVIQVDQSGLFLPSRDYYLNRTANEKVLTAYLDYMEELGMLLGGRPTSTREQMQQV    351 - 420
LELEIQLANITVPQDQRRDEEKIYHKMSISELQALAPSMDWLEFLSFLLSPLELSDSEPVVVYGMDYLQQ    421 - 490
VSELINRTEPSILNNYLIWNLVQKTTSSLDRRFESAQEKLLETLYGTKKSCVPRWQTCISNTDDALGFAL    491 - 560
GSLFVKATFDRQSKEIAEGMISEIRTAFEEALGQLVWMDEKTRQAAKEKADAIYDMIGFPDFILEPKELD    561 - 630
DVYDGYEISEDSFFQNMLNLYNFSAKVMADQLRKPPSRDQWSMTPQTVNAYYLPTKNEIVFPAGILQAPF    631 - 700
YARNHPKALNFGGIGVVMGHELTHAFDDQGREYDKEGNLRPWWQNESLAAFRNHTACMEEQYNQYQVNGE    701 - 770
RLNGRQTLGENIADNGGLKAAYNAYKAWLRKHGEEQQLPAVGLTNHQLFFVGFAQVWCSVRTPESSHEGL    771 - 840
VTDPHSPARFRVLGTLSNSRDFLRHFGCPVGSPMNPGQLCEVW                               841 - 883
//

Text Mined References (28)

PMID Year Title