Property Summary

NCBI Gene PubMed Count 160
Grant Count 199
R01 Count 116
Funding $21,986,499.01
PubMed Score 431.86
PubTator Score 325.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
group 3 medulloblastoma 1.900 0.000
medulloblastoma, large-cell 1.700 0.000
lung cancer 2.000 0.000

Synonym

Accession O60341 A8MWP9 Q5TH94 Q5TH95 Q86VT7 Q8IXK4 Q8NDP6 Q8TAZ3 Q96AW4
Symbols AOF2
CPRF
KDM1
LSD1
BHC110

Gene

PDB

2IW5   2UXN   2UXX   2V1D   2X0L   2XAF   2XAG   2XAH   2XAJ   2XAQ   2XAS   2Y48   3ZMS   3ZMT   3ZMU   3ZMV   3ZMZ   3ZN0   3ZN1   4BAY   4KUM   4UV8   4UV9   4UVA   4UVB   4UVC   4UXN   4XBF   5L3B   5L3C   5L3D   5L3F   5AFW   4CZZ   2COM   2DW4   2EJR   2H94   2HKO   2L3D   2Z3Y   2Z5U   3ABT   3ABU   5IT3   5L3E  

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
687009 confirmatory 1 / 18 / 10 qHTS Assay for Inhibitors of Human Jumonji Domain Containing 2E (JMJD2E): Counterscreen with LSD1

Gene RIF (143)

PMID Text
26970896 Data show that lysine-specific demethylase 1 (LSD1) is a drug target for mixed lineage leukemia (MLL)-rearranged leukemia, and LSD1 inhibitors are potential therapeutics for the malignancy.
26751641 These data link the assembly of methylated KDM1A and CHD1 with AR-dependent transcription and genomic translocations, thereby providing mechanistic insight into the formation of TMPRSS2-ERG gene fusions during prostate-tumor evolution.
26748182 When LSD1 activity was below 50%, pluripotency of human induced pluripotent stem cells was impaired
26719542 Results support a model in which the HBXIP/Hotair/LSD1 complex serves as a critical effector of c-Myc in activating transcription of its target genes, illuminating long-standing questions on how c-Myc drives carcinogenesis.
26673564 these data suggest that KDM1A likely contains a histone H3 secondary specificity element on the enzyme surface that contributes significantly to its recognition of substrates and products.
26534764 Results show that LSD1 is upregulated in human prostate cancer and plays an oncogenic role.
26489763 These results highlight a novel mechanism regulating LSD1 expression and identify LSD1 as a promising therapeutic target for treating metastatic ovarian cancer driven by EGF signaling.
26460616 Authors found positive correlations between LSD1 expression and other proteins: epithelial-mesenchymal transition markers, C-myc and cyclin-related proteins. Inhibiting LSD1 expression in vitro impaired the proliferation and invasiveness of GBC cells and also downregulated c-myc expression and consequently inhibited GBC cell proliferation.
26364657 Based on the results and analysis, it may provide some useful information for future novel LSD1 inhibitor design.
26240060 LSD1 may contribute to malignant behavior by regulating the invasive activity and metabolism, activating the glycolytic pathway and inhibiting the mitochondrial respiration of esophageal cancer cells
More...

AA Sequence

MLSGKKAAAAAAAAAAAATGTEAGPGTAGGSENGSEVAAQPAGLSGPAEVGPGAVGERTPRKKEPPRASP      1 - 70
PGGLAEPPGSAGPQAGPTVVPGSATPMETGIAETPEGRRTSRRKRAKVEYREMDESLANLSEDEYYSEEE     71 - 140
RNAKAEKEKKLPPPPPQAPPEEENESEPEEPSGVEGAAFQSRLPHDRMTSQEAACFPDIISGPQQTQKVF    141 - 210
LFIRNRTLQLWLDNPKIQLTFEATLQQLEAPYNSDTVLVHRVHSYLERHGLINFGIYKRIKPLPTKKTGK    211 - 280
VIIIGSGVSGLAAARQLQSFGMDVTLLEARDRVGGRVATFRKGNYVADLGAMVVTGLGGNPMAVVSKQVN    281 - 350
MELAKIKQKCPLYEANGQAVPKEKDEMVEQEFNRLLEATSYLSHQLDFNVLNNKPVSLGQALEVVIQLQE    351 - 420
KHVKDEQIEHWKKIVKTQEELKELLNKMVNLKEKIKELHQQYKEASEVKPPRDITAEFLVKSKHRDLTAL    421 - 490
CKEYDELAETQGKLEEKLQELEANPPSDVYLSSRDRQILDWHFANLEFANATPLSTLSLKHWDQDDDFEF    491 - 560
TGSHLTVRNGYSCVPVALAEGLDIKLNTAVRQVRYTASGCEVIAVNTRSTSQTFIYKCDAVLCTLPLGVL    561 - 630
KQQPPAVQFVPPLPEWKTSAVQRMGFGNLNKVVLCFDRVFWDPSVNLFGHVGSTTASRGELFLFWNLYKA    631 - 700
PILLALVAGEAAGIMENISDDVIVGRCLAILKGIFGSSAVPQPKETVVSRWRADPWARGSYSYVAAGSSG    701 - 770
NDYDLMAQPITPGPSIPGAPQPIPRLFFAGEHTIRNYPATVHGALLSGLREAGRIADQFLGAMYTLPRQA    771 - 840
TPGVPAQQSPSM                                                              841 - 852
//

Text Mined References (176)

PMID Year Title
26970896 2016 Pharmacological inhibition of LSD1 for the treatment of MLL-rearranged leukemia.
26751641 2016 Assembly of methylated KDM1A and CHD1 drives androgen receptor-dependent transcription and translocation.
26748182 2016 The effects of LSD1 inhibition on self-renewal and differentiation of human induced pluripotent stem cells.
26719542 2016 HBXIP and LSD1 Scaffolded by lncRNA Hotair Mediate Transcriptional Activation by c-Myc.
26673564 2016 Lysine-Specific Demethylase 1A (KDM1A/LSD1): Product Recognition and Kinetic Analysis of Full-Length Histones.
26656649 2016 Gene discovery for Mendelian conditions via social networking: de novo variants in KDM1A cause developmental delay and distinctive facial features.
26534764 2016 Overexpression of lysine-specific demethylase 1 promotes androgen-independent transition of human prostate cancer LNCaP cells through activation of the AR signaling pathway and suppression of the p53 signaling pathway.
26489763 2015 Lysine-specific demethylase 1 mediates epidermal growth factor signaling to promote cell migration in ovarian cancer cells.
26460616 2015 Lysine-specific demethylase 1 promotes tumorigenesis and predicts prognosis in gallbladder cancer.
26364657 2015 Insight into the binding mode of a novel LSD1 inhibitor by molecular docking and molecular dynamics simulations.
More...