Property Summary

NCBI Gene PubMed Count 22
PubMed Score 45.77
PubTator Score 112.82

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
adult high grade glioma -2.200 2.2e-08
astrocytic glioma -1.500 5.3e-04
Astrocytoma, Pilocytic -2.300 3.8e-11
atypical teratoid / rhabdoid tumor 1.200 1.0e-05
ependymoma 1.600 7.6e-03
Gaucher disease type 1 -1.200 2.0e-02
glioblastoma -2.300 2.2e-13
group 4 medulloblastoma 1.300 2.4e-03
invasive ductal carcinoma 1.200 2.3e-03
malignant mesothelioma 1.200 1.8e-03
medulloblastoma, large-cell -2.100 5.4e-07
non-small cell lung cancer 1.227 1.1e-19
oligodendroglioma 1.200 4.4e-03
osteosarcoma 2.094 2.0e-05
ovarian cancer -1.900 1.0e-05
permanent atrial fibrillation -1.300 1.0e-03
primitive neuroectodermal tumor -1.300 6.8e-03
psoriasis -1.200 1.7e-03
Rheumatoid arthritis 1.900 1.1e-02
subependymal giant cell astrocytoma -2.056 2.4e-02
Waldenstrons macroglobulinemia 1.114 1.2e-02

Gene RIF (6)

AA Sequence

MDTAEEDICRVCRSEGTPEKPLYHPCVCTGSIKFIHQECLVQWLKHSRKEYCELCKHRFAFTPIYSPDMP      1 - 70
SRLPIQDIFAGLVTSIGTAIRYWFHYTLVAFAWLGVVPLTACRIYKCLFTGSVSSLLTLPLDMLSTENLL     71 - 140
ADCLQGCFVVTCTLCAFISLVWLREQIVHGGAPIWLEHAAPPFNAAGHHQNEAPAGGNGAENVAADQPAN    141 - 210
PPAENAVVGENPDAQDDQAEEEEEDNEEEDDAGVEDAADANNGAQDDMNWNALEWDRAAEELTWERMLGL    211 - 280
DGSLVFLEHVFWVVSLNTLFILVFAFCPYHIGHFSLVGLGFEEHVQASHFEGLITTIVGYILLAITLIIC    281 - 350
HGLATLVKFHRSRRLLGVCYIVVKVSLLVVVEIGVFPLICGWWLDICSLEMFDATLKDRELSFQSAPGTT    351 - 420
MFLHWLVGMVYVFYFASFILLLREVLRPGVLWFLRNLNDPDFNPVQEMIHLPIYRHLRRFILSVIVFGSI    421 - 490
VLLMLWLPIRIIKSVLPNFLPYNVMLYSDAPVSELSLELLLLQVVLPALLEQGHTRQWLKGLVRAWTVTA    491 - 560
GYLLDLHSYLLGDQEENENSANQQVNNNQHARNNNAIPVVGEGLHAAHQAILQQGGPVGFQPYRRPLNFP    561 - 630
LRIFLLIVFMCITLLIASLICLTLPVFAGRWLMSFWTGTAKIHELYTAACGLYVCWLTIRAVTVMVAWMP    631 - 700
QGRRVIFQKVKEWSLMIMKTLIVAVLLAGVVPLLLGLLFELVIVAPLRVPLDQTPLFYPWQDWALGVLHA    701 - 770
KIIAAITLMGPQWWLKTVIEQVYANGIRNIDLHYIVRKLAAPVISVLLLSLCVPYVIASGVVPLLGVTAE    771 - 840
MQNLVHRRIYPFLLMVVVLMAILSFQVRQFKRLYEHIKNDKYLVGQRLVNYERKSGKQGSSPPPPQSSQE    841 - 910
//

Text Mined References (24)

PMID Year Title