Property Summary

NCBI Gene PubMed Count 20
Grant Count 24
R01 Count 11
Funding $1,603,273.87
PubMed Score 43.91
PubTator Score 112.82

Knowledge Summary

Patent

No data available

Expression

Gene RIF (5)

PMID Text
26527619 Loss of MARCH6 increases expression of SREBP-regulated genes involved in cholesterol biosynthesis and lipoprotein uptake.
24840124 Data suggest that unsaturated fatty acids (oleate; oleoyl-CoA) stabilize SM/SQLE (squalene monooxygenase; catalyzes 1st oxygenation step in cholesterol synthesis) most likely via inhibition of poly-ubiquitination by MARCH6.
24449766 MARCH6 and squalene monooxygenase (SM) physically interact, and consistent with MARCH6 acting as an E3 ligase, its overexpression reduces SM abundance in a RING-dependent manner.
19651899 TEB4 interacts with and mediates loss of type 2 iodothyronine deiodinase (D2)activity, indicating that D2 ubiquitination and degradation can be tissue specific, depending on WSB-1 and TEB4 expression levels.
16373356 analysis of yeast endoplasmic reticulum-localized ubiquitin ligase Doa10 and comparison with its human ortholog TEB4

AA Sequence

MDTAEEDICRVCRSEGTPEKPLYHPCVCTGSIKFIHQECLVQWLKHSRKEYCELCKHRFAFTPIYSPDMP      1 - 70
SRLPIQDIFAGLVTSIGTAIRYWFHYTLVAFAWLGVVPLTACRIYKCLFTGSVSSLLTLPLDMLSTENLL     71 - 140
ADCLQGCFVVTCTLCAFISLVWLREQIVHGGAPIWLEHAAPPFNAAGHHQNEAPAGGNGAENVAADQPAN    141 - 210
PPAENAVVGENPDAQDDQAEEEEEDNEEEDDAGVEDAADANNGAQDDMNWNALEWDRAAEELTWERMLGL    211 - 280
DGSLVFLEHVFWVVSLNTLFILVFAFCPYHIGHFSLVGLGFEEHVQASHFEGLITTIVGYILLAITLIIC    281 - 350
HGLATLVKFHRSRRLLGVCYIVVKVSLLVVVEIGVFPLICGWWLDICSLEMFDATLKDRELSFQSAPGTT    351 - 420
MFLHWLVGMVYVFYFASFILLLREVLRPGVLWFLRNLNDPDFNPVQEMIHLPIYRHLRRFILSVIVFGSI    421 - 490
VLLMLWLPIRIIKSVLPNFLPYNVMLYSDAPVSELSLELLLLQVVLPALLEQGHTRQWLKGLVRAWTVTA    491 - 560
GYLLDLHSYLLGDQEENENSANQQVNNNQHARNNNAIPVVGEGLHAAHQAILQQGGPVGFQPYRRPLNFP    561 - 630
LRIFLLIVFMCITLLIASLICLTLPVFAGRWLMSFWTGTAKIHELYTAACGLYVCWLTIRAVTVMVAWMP    631 - 700
QGRRVIFQKVKEWSLMIMKTLIVAVLLAGVVPLLLGLLFELVIVAPLRVPLDQTPLFYPWQDWALGVLHA    701 - 770
KIIAAITLMGPQWWLKTVIEQVYANGIRNIDLHYIVRKLAAPVISVLLLSLCVPYVIASGVVPLLGVTAE    771 - 840
MQNLVHRRIYPFLLMVVVLMAILSFQVRQFKRLYEHIKNDKYLVGQRLVNYERKSGKQGSSPPPPQSSQE    841 - 910
//

Text Mined References (22)

PMID Year Title
26527619 2015 A MARCH6 and IDOL E3 Ubiquitin Ligase Circuit Uncouples Cholesterol Synthesis from Lipoprotein Uptake in Hepatocytes.
25088257 2014 Ubiquitin-specific protease 19 regulates the stability of the E3 ubiquitin ligase MARCH6.
24840124 2014 Squalene mono-oxygenase, a key enzyme in cholesterol synthesis, is stabilized by unsaturated fatty acids.
24449766 2014 The E3 ubiquitin ligase MARCH6 degrades squalene monooxygenase and affects 3-hydroxy-3-methyl-glutaryl coenzyme A reductase and the cholesterol synthesis pathway.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22446040 2012 A novel locus for body mass index on 5p15.2: a meta-analysis of two genome-wide association studies.
21679772 2011 Type 2 deiodinase at the crossroads of thyroid hormone action.
19946888 2010 Defining the membrane proteome of NK cells.
19651899 2009 The E3 ubiquitin ligase TEB4 mediates degradation of type 2 iodothyronine deiodinase.
19103148 2009 CYP3A4 ubiquitination by gp78 (the tumor autocrine motility factor receptor, AMFR) and CHIP E3 ligases.
More...