Property Summary

NCBI Gene PubMed Count 20
PubMed Score 43.91
PubTator Score 112.82

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
non-small cell lung cancer 2798 1.11142863107673E-19
posterior fossa group A ependymoma 1511 1.67203322606578E-17
pilocytic astrocytoma 3086 2.68908916232102E-11
pediatric high grade glioma 2712 2.96802333647209E-10
atypical teratoid / rhabdoid tumor 4369 2.13553900915859E-9
glioblastoma 5572 3.92285841162127E-9
medulloblastoma, large-cell 6234 5.39796938736351E-7
malignant mesothelioma 3163 7.57527928018462E-7
ovarian cancer 8492 5.45746472880517E-6
sonic hedgehog group medulloblastoma 1482 1.05453242469863E-5
osteosarcoma 7933 1.6451376555693E-4
astrocytic glioma 2241 5.25660763376532E-4
permanent atrial fibrillation 44 0.0010007452923085
psoriasis 6685 0.00165052633686596
invasive ductal carcinoma 2950 0.0022914990553101
oligodendroglioma 2849 0.0044037621672043
primitive neuroectodermal tumor 3031 0.0068324025282996
Rheumatoid Arthritis 1171 0.0111213342335771
Waldenstrons macroglobulinemia 765 0.0122930575352956
Gaucher disease type 1 171 0.0196570268435125
subependymal giant cell astrocytoma 2287 0.0243110777933024
Disease Target Count Z-score Confidence
Acquired metabolic disease 267 0.0 1.0

Expression

Synonym

Accession O60337 A5PKZ4 B4DKJ2 B4DT33 D3DTC8 O14670 Q86X77
Symbols TEB4
DOA10
RNF176
MARCH-VI

Gene

PANTHER Protein Class (2)

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans OMA EggNOG Inparanoid
S.cerevisiae EggNOG Inparanoid

 GWAS Trait (1)

Gene RIF (5)

PMID Text
26527619 Loss of MARCH6 increases expression of SREBP-regulated genes involved in cholesterol biosynthesis and lipoprotein uptake.
24840124 Data suggest that unsaturated fatty acids (oleate; oleoyl-CoA) stabilize SM/SQLE (squalene monooxygenase; catalyzes 1st oxygenation step in cholesterol synthesis) most likely via inhibition of poly-ubiquitination by MARCH6.
24449766 MARCH6 and squalene monooxygenase (SM) physically interact, and consistent with MARCH6 acting as an E3 ligase, its overexpression reduces SM abundance in a RING-dependent manner.
19651899 TEB4 interacts with and mediates loss of type 2 iodothyronine deiodinase (D2)activity, indicating that D2 ubiquitination and degradation can be tissue specific, depending on WSB-1 and TEB4 expression levels.
16373356 analysis of yeast endoplasmic reticulum-localized ubiquitin ligase Doa10 and comparison with its human ortholog TEB4

AA Sequence

MDTAEEDICRVCRSEGTPEKPLYHPCVCTGSIKFIHQECLVQWLKHSRKEYCELCKHRFAFTPIYSPDMP      1 - 70
SRLPIQDIFAGLVTSIGTAIRYWFHYTLVAFAWLGVVPLTACRIYKCLFTGSVSSLLTLPLDMLSTENLL     71 - 140
ADCLQGCFVVTCTLCAFISLVWLREQIVHGGAPIWLEHAAPPFNAAGHHQNEAPAGGNGAENVAADQPAN    141 - 210
PPAENAVVGENPDAQDDQAEEEEEDNEEEDDAGVEDAADANNGAQDDMNWNALEWDRAAEELTWERMLGL    211 - 280
DGSLVFLEHVFWVVSLNTLFILVFAFCPYHIGHFSLVGLGFEEHVQASHFEGLITTIVGYILLAITLIIC    281 - 350
HGLATLVKFHRSRRLLGVCYIVVKVSLLVVVEIGVFPLICGWWLDICSLEMFDATLKDRELSFQSAPGTT    351 - 420
MFLHWLVGMVYVFYFASFILLLREVLRPGVLWFLRNLNDPDFNPVQEMIHLPIYRHLRRFILSVIVFGSI    421 - 490
VLLMLWLPIRIIKSVLPNFLPYNVMLYSDAPVSELSLELLLLQVVLPALLEQGHTRQWLKGLVRAWTVTA    491 - 560
GYLLDLHSYLLGDQEENENSANQQVNNNQHARNNNAIPVVGEGLHAAHQAILQQGGPVGFQPYRRPLNFP    561 - 630
LRIFLLIVFMCITLLIASLICLTLPVFAGRWLMSFWTGTAKIHELYTAACGLYVCWLTIRAVTVMVAWMP    631 - 700
QGRRVIFQKVKEWSLMIMKTLIVAVLLAGVVPLLLGLLFELVIVAPLRVPLDQTPLFYPWQDWALGVLHA    701 - 770
KIIAAITLMGPQWWLKTVIEQVYANGIRNIDLHYIVRKLAAPVISVLLLSLCVPYVIASGVVPLLGVTAE    771 - 840
MQNLVHRRIYPFLLMVVVLMAILSFQVRQFKRLYEHIKNDKYLVGQRLVNYERKSGKQGSSPPPPQSSQE    841 - 910
//

Text Mined References (22)

PMID Year Title
26527619 2015 A MARCH6 and IDOL E3 Ubiquitin Ligase Circuit Uncouples Cholesterol Synthesis from Lipoprotein Uptake in Hepatocytes.
25088257 2014 Ubiquitin-specific protease 19 regulates the stability of the E3 ubiquitin ligase MARCH6.
24840124 2014 Squalene mono-oxygenase, a key enzyme in cholesterol synthesis, is stabilized by unsaturated fatty acids.
24449766 2014 The E3 ubiquitin ligase MARCH6 degrades squalene monooxygenase and affects 3-hydroxy-3-methyl-glutaryl coenzyme A reductase and the cholesterol synthesis pathway.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22446040 2012 A novel locus for body mass index on 5p15.2: a meta-analysis of two genome-wide association studies.
21679772 2011 Type 2 deiodinase at the crossroads of thyroid hormone action.
19946888 2010 Defining the membrane proteome of NK cells.
19651899 2009 The E3 ubiquitin ligase TEB4 mediates degradation of type 2 iodothyronine deiodinase.
19103148 2009 CYP3A4 ubiquitination by gp78 (the tumor autocrine motility factor receptor, AMFR) and CHIP E3 ligases.
More...