Property Summary

NCBI Gene PubMed Count 14
PubMed Score 4.01
PubTator Score 2.49

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
NEPHRONOPHTHISIS 20 1 0.0 0.0
Disease Target Count P-value
posterior fossa group A ependymoma 468 2.9e-09
osteosarcoma 7950 8.7e-07
medulloblastoma 720 3.7e-06
glioblastoma 5792 4.6e-05
psoriasis 6694 5.6e-05
medulloblastoma, large-cell 6241 3.7e-04
Disease Target Count Z-score Confidence
Breast cancer 3578 0.0 0.5
Carcinoma 11493 0.0 1.1
Kidney cancer 2613 0.0 0.5
Disease Target Count Z-score Confidence
Nephronophthisis 80 4.118 2.1

Expression

  Differential Expression (6)

Disease log2 FC p
glioblastoma -1.200 4.6e-05
medulloblastoma -1.100 3.7e-06
medulloblastoma, large-cell 1.300 3.7e-04
osteosarcoma 2.415 8.7e-07
posterior fossa group A ependymoma -1.100 2.9e-09
psoriasis 1.900 5.6e-05

 GO Function (1)

Gene RIF (4)

AA Sequence

MAVEGSTITSRIKNLLRSPSIKLRRSKAGNRREDLSSKVTLEKVLGITVSGGRGLACDPRSGLVAYPAGC      1 - 70
VVVLFNPRKHKQHHILNSSRKTITALAFSPDGKYLVTGESGHMPAVRVWDVAEHSQVAELQEHKYGVACV     71 - 140
AFSPSAKYIVSVGYQHDMIVNVWAWKKNIVVASNKVSSRVTAVSFSEDCSYFVTAGNRHIKFWYLDDSKT    141 - 210
SKVNATVPLLGRSGLLGELRNNLFTDVACGRGKKADSTFCITSSGLLCEFSDRRLLDKWVELRNIDSFTT    211 - 280
TVAHCISVSQDYIFCGCADGTVRLFNPSNLHFLSTLPRPHALGTDIASVTEASRLFSGVANARYPDTIAL    281 - 350
TFDPTNQWLSCVYNDHSIYVWDVRDPKKVGKVYSALYHSSCVWSVEVYPEVKDSNQACLPPSSFITCSSD    351 - 420
NTIRLWNTESSGVHGSTLHRNILSSDLIKIIYVDGNTQALLDTELPGGDKADASLLDPRVGIRSVCVSPN    421 - 490
GQHLASGDRMGTLRVHELQSLSEMLKVEAHDSEILCLEYSKPDTGLKLLASASRDRLIHVLDAGREYSLQ    491 - 560
QTLDEHSSSITAVKFAASDGQVRMISCGADKSIYFRTAQKSGDGVQFTRTHHVVRKTTLYDMDVEPSWKY    561 - 630
TAIGCQDRNIRIFNISSGKQKKLFKGSQGEDGTLIKVQTDPSGIYIATSCSDKNLSIFDFSSGECVATMF    631 - 700
GHSEIVTGMKFSNDCKHLISVSGDSCIFVWRLSSEMTISMRQRLAELRQRQRGGKQQGPSSPQRASGPNR    701 - 770
HQAPSMLSPGPALSSDSDKEGEDEGTEEELPALPVLAKSTKKALASVPSPALPRSLSHWEMSRAQESVGF    771 - 840
LDPAPAANPGPRRRGRWVQPGVELSVRSMLDLRQLETLAPSLQDPSQDSLAIIPSGPRKHGQEALETSLT    841 - 910
SQNEKPPRPQASQPCSYPHIIRLLSQEEGVFAQDLEPAPIEDGIVYPEPSDNPTMDTSEFQVQAPARGTL    911 - 980
GRVYPGSRSSEKHSPDSACSVDYSSSCLSSPEHPTEDSESTEPLSVDGISSDLEEPAEGDEEEEEEEGGM    981 - 1050
GPYGLQEGSPQTPDQEQFLKQHFETLASGAAPGAPVQVPERSESRSISSRFLLQVQTRPLREPSPSSSSL   1051 - 1120
ALMSRPAQVPQASGEQPRGNGANPPGAPPEVEPSSGNPSPQQAASVLLPRCRLNPDSSWAPKRVATASPF   1121 - 1190
SGLQKAQSVHSLVPQERHEASLQAPSPGALLSREIEAQDGLGSLPPADGRPSRPHSYQNPTTSSMAKISR   1191 - 1260
SISVGENLGLVAEPQAHAPIRVSPLSKLALPSRAHLVLDIPKPLPDRPTLAAFSPVTKGRAPGEAEKPGF   1261 - 1330
PVGLGKAHSTTERWACLGEGTTPKPRTECQAHPGPSSPCAQQLPVSSLFQGPENLQPPPPEKTPNPMECT   1331 - 1400
KPGAALSQDSEPAVSLEQCEQLVAELRGSVRQAVRLYHSVAGCKMPSAEQSRIAQLLRDTFSSVRQELEA   1401 - 1470
VAGAVLSSPGSSPGAVGAEQTQALLEQYSELLLRAVERRMERKL                             1471 - 1514
//

Text Mined References (21)

PMID Year Title