Property Summary

NCBI Gene PubMed Count 67
Grant Count 26
R01 Count 19
Funding $2,580,917.75
PubMed Score 108.91
PubTator Score 102.22

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Gene RIF (39)

PMID Text
26812016 that KIF1Bbeta affects mitochondrial dynamics through calcineurin-dependent dephosphorylation of Dynamin-related protein 1 (DRP1), causing mitochondrial fission and apoptosis
26576027 Increased KIF1B was associated with worse WHO pathological classification, Karnofsky performance status, and prognosis. Silencing KIF1B inhibited expression of membranal MT1-MMP.
26217094 Downregulation of KIF1B in hepatocellular carcinoma tissues is associated with poor prognosis.
25854172 the rs17401966 polymorphism likely regulates KIF1B mRNA expression and thus may be associated with epithelial ovarian cancer risk in Eastern Chinese women.
25818806 The ability of exogenously expressed FEZ1 binding to kinesin-1 to promote early HIV-1 infection, leading to the movement of HIV-1 CA core to the nucleus
25518808 The tumor suppressor DLC2 and Kif1B are central components of a signaling network that guides spindle positioning, cell-cell adhesion and mitotic fidelity.
25355294 Results from targeted sequencing in patients with acute lymphoblastic leukemia identified KMT2D and KIF1B as novel putative driver genes and a putative regulatory non-coding variant that coincided with overexpression of the growth factor MDK.
25153661 The variant G allele of rs17401966 may be a favorable biomarker for the prognosis of intermediate or advanced hepatitis B virus-related hepatocellular carcinoma patients in this Chinese population
24952890 The meta-analysis showed a significant association between kinesin family member 1B (KIF1B) single nucleotide polymorphism (rs17401966) and hepatocellular carcinoma (HCC).
24469107 Results show that KIF1Bbeta has neuroblastoma tumor-suppressor properties and promotes and requires nuclear-localized DHX9 for its apoptotic function by activating XAF1 expression.
More...

AA Sequence

MSGASVKVAVRVRPFNSRETSKESKCIIQMQGNSTSIINPKNPKEAPKSFSFDYSYWSHTSPEDPCFASQ      1 - 70
NRVYNDIGKEMLLHAFEGYNVCIFAYGQTGAGKSYTMMGKQEESQAGIIPQLCEELFEKINDNCNEEMSY     71 - 140
SVEVSYMEIYCERVRDLLNPKNKGNLRVREHPLLGPYVEDLSKLAVTSYTDIADLMDAGNKARTVAATNM    141 - 210
NETSSRSHAVFTIVFTQKKHDNETNLSTEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGK    211 - 280
VISALAEVDNCTSKSKKKKKTDFIPYRDSVLTWLLRENLGGNSRTAMVAALSPADINYDETLSTLRYADR    281 - 350
AKQIKCNAVINEDPNAKLVRELKEEVTRLKDLLRAQGLGDIIDIDPLIDDYSGSGSKYLKDFQNNKHRYL    351 - 420
LASENQRPGHFSTASMGSLTSSPSSCSLSSQVGLTSVTSIQERIMSTPGGEEAIERLKESEKIIAELNET    421 - 490
WEEKLRKTEAIRMEREALLAEMGVAIREDGGTLGVFSPKKTPHLVNLNEDPLMSECLLYYIKDGITRVGQ    491 - 560
ADAERRQDIVLSGAHIKEEHCIFRSERSNSGEVIVTLEPCERSETYVNGKRVSQPVQLRSGNRIIMGKNH    561 - 630
VFRFNHPEQARAEREKTPSAETPSEPVDWTFAQRELLEKQGIDMKQEMEKRLQEMEILYKKEKEEADLLL    631 - 700
EQQRLDYESKLQALQKQVETRSLAAETTEEEEEEEEVPWTQHEFELAQWAFRKWKSHQFTSLRDLLWGNA    701 - 770
VYLKEANAISVELKKKVQFQFVLLTDTLYSPLPPELLPTEMEKTHEDRPFPRTVVAVEVQDLKNGATHYW    771 - 840
SLEKLKQRLDLMREMYDRAGEMASSAQDESETTVTGSDPFYDRFHWFKLVGSSPIFHGCVNERLADRTPS    841 - 910
PTFSTADSDITELADEQQDEMEDFDDEAFVDDAGSDAGTEEGSDLFSDGHDPFYDRSPWFILVGRAFVYL    911 - 980
SNLLYPVPLIHRVAIVSEKGEVRGFLRVAVQAIAADEEAPDYGSGIRQSGTAKISFDNEYFNQSDFSSVA    981 - 1050
MTRSGLSLEELRIVEGQGQSSEVITPPEEISRINDLDLKSSTLLDGKMVMEGFSEEIGNHLKLGSAFTFR   1051 - 1120
VTVLQASGILPEYADIFCQFNFLHRHDEAFSTEPLKNNGRGSPLAFYHVQNIAVEITESFVDYIKTKPIV   1121 - 1190
FEVFGHYQQHPLHLQGQELNSPPQPCRRFFPPPMPLSKPVPATKLNTMSKTSLGQSMSKYDLLVWFEISE   1191 - 1260
LEPTGEYIPAVVDHTAGLPCQGTFLLHQGIQRRITVTIIHEKGSELHWKDVRELVVGRIRNKPEVDEAAV   1261 - 1330
DAILSLNIISAKYLKSSHNSSRTFYRFEAVWDSSLHNSLLLNRVTPYGEKIYMTLSAYLELDHCIQPAVI   1331 - 1400
TKDVCMVFYSRDAKISPPRSLRSLFGSGYSKSPDSNRVTGIYELSLCKMSDTGSPGMQRRRRKILDTSVA   1401 - 1470
YVRGEENLAGWRPRGDSLILEHQWELEKLELLHEVEKTRHFLLLRERLGDSIPKSLSDSLSPSLSSGTLS   1471 - 1540
TSTSISSQISTTTFESAITPSESSGYDSGDIESLVDREKELATKCLQLLTHTFNREFSQVHGSVSDCKLS   1541 - 1610
DISPIGRDPSESSFSSATLTPSSTCPSLVDSRSNSLDQKTPEANSRASSPCPEFEQFQIVPAVETPYLAR   1611 - 1680
AGKNEFLNLVPDIEEIRPSSVVSKKGYLHFKEPLYSNWAKHFVVVRRPYVFIYNSDKDPVERGIINLSTA   1681 - 1750
QVEYSEDQQAMVKTPNTFAVCTKHRGVLLQALNDKDMNDWLYAFNPLLAGTIRSKLSRRCPSQSKY       1751 - 1816
//

Text Mined References (74)

PMID Year Title
26812016 2016 The 1p36 Tumor Suppressor KIF 1B? Is Required for Calcineurin Activation, Controlling Mitochondrial Fission and Apoptosis.
26576027 2016 KIF1B promotes glioma migration and invasion via cell surface localization of MT1-MMP.
26217094 2015 Downregulation of KIF1B mRNA in hepatocellular carcinoma tissues correlates with poor prognosis.
25854172 2015 Polymorphisms in the kinesin-like factor 1 B gene and risk of epithelial ovarian cancer in Eastern Chinese women.
25518808 2014 The tumour suppressor DLC2 ensures mitotic fidelity by coordinating spindle positioning and cell-cell adhesion.
25416956 2014 A proteome-scale map of the human interactome network.
25355294 2015 The mutational landscape in pediatric acute lymphoblastic leukemia deciphered by whole genome sequencing.
25153661 2014 A genetic variant at KIF1B predicts clinical outcome of HBV-related hepatocellular carcinoma in Chinese.
24952890 2014 Association between KIF1B rs17401966 polymorphism and hepatocellular carcinoma risk: a meta-analysis involving 17,210 subjects.
24623842 2014 GABRA1 and STXBP1: novel genetic causes of Dravet syndrome.
More...