Property Summary

NCBI Gene PubMed Count 70
PubMed Score 118.02
PubTator Score 102.22

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (9)

Disease Target Count Z-score Confidence
Kidney cancer 2613 0.0 0.7
Large intestine cancer 126 0.0 0.6
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 3.0
Liver cancer 604 0.0 3.0
Multiple Sclerosis 540 0.0 3.0
Disease Target Count Z-score Confidence
Paraganglioma 15 0.0 5.0
Disease Target Count
Neuroblastoma, Susceptibility to 2

Expression

  Differential Expression (18)

Disease log2 FC p
lung cancer 1.400 9.1e-04
adult high grade glioma -1.300 3.9e-06
Amyotrophic lateral sclerosis 1.027 1.5e-06
astrocytic glioma 1.500 2.4e-02
Astrocytoma, Pilocytic -1.300 1.6e-08
atypical teratoid / rhabdoid tumor -1.100 3.7e-03
gastric carcinoma 1.100 6.8e-03
glioblastoma -1.200 2.3e-05
group 3 medulloblastoma 1.100 2.6e-02
medulloblastoma, large-cell -1.200 1.4e-04
oligodendroglioma 1.100 4.0e-10
osteosarcoma 1.044 1.2e-04
ovarian cancer -1.200 4.4e-06
pituitary cancer 1.400 1.6e-06
posterior fossa group A ependymoma -1.100 1.3e-10
primary pancreatic ductal adenocarcinoma 1.025 2.1e-02
subependymal giant cell astrocytoma -2.344 1.0e-02
type 2 diabetes -1.032 1.7e-02

Protein-protein Interaction (7)

Gene RIF (42)

AA Sequence

MSGASVKVAVRVRPFNSRETSKESKCIIQMQGNSTSIINPKNPKEAPKSFSFDYSYWSHTSPEDPCFASQ      1 - 70
NRVYNDIGKEMLLHAFEGYNVCIFAYGQTGAGKSYTMMGKQEESQAGIIPQLCEELFEKINDNCNEEMSY     71 - 140
SVEVSYMEIYCERVRDLLNPKNKGNLRVREHPLLGPYVEDLSKLAVTSYTDIADLMDAGNKARTVAATNM    141 - 210
NETSSRSHAVFTIVFTQKKHDNETNLSTEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGK    211 - 280
VISALAEVDNCTSKSKKKKKTDFIPYRDSVLTWLLRENLGGNSRTAMVAALSPADINYDETLSTLRYADR    281 - 350
AKQIKCNAVINEDPNAKLVRELKEEVTRLKDLLRAQGLGDIIDIDPLIDDYSGSGSKYLKDFQNNKHRYL    351 - 420
LASENQRPGHFSTASMGSLTSSPSSCSLSSQVGLTSVTSIQERIMSTPGGEEAIERLKESEKIIAELNET    421 - 490
WEEKLRKTEAIRMEREALLAEMGVAIREDGGTLGVFSPKKTPHLVNLNEDPLMSECLLYYIKDGITRVGQ    491 - 560
ADAERRQDIVLSGAHIKEEHCIFRSERSNSGEVIVTLEPCERSETYVNGKRVSQPVQLRSGNRIIMGKNH    561 - 630
VFRFNHPEQARAEREKTPSAETPSEPVDWTFAQRELLEKQGIDMKQEMEKRLQEMEILYKKEKEEADLLL    631 - 700
EQQRLDYESKLQALQKQVETRSLAAETTEEEEEEEEVPWTQHEFELAQWAFRKWKSHQFTSLRDLLWGNA    701 - 770
VYLKEANAISVELKKKVQFQFVLLTDTLYSPLPPELLPTEMEKTHEDRPFPRTVVAVEVQDLKNGATHYW    771 - 840
SLEKLKQRLDLMREMYDRAGEMASSAQDESETTVTGSDPFYDRFHWFKLVGSSPIFHGCVNERLADRTPS    841 - 910
PTFSTADSDITELADEQQDEMEDFDDEAFVDDAGSDAGTEEGSDLFSDGHDPFYDRSPWFILVGRAFVYL    911 - 980
SNLLYPVPLIHRVAIVSEKGEVRGFLRVAVQAIAADEEAPDYGSGIRQSGTAKISFDNEYFNQSDFSSVA    981 - 1050
MTRSGLSLEELRIVEGQGQSSEVITPPEEISRINDLDLKSSTLLDGKMVMEGFSEEIGNHLKLGSAFTFR   1051 - 1120
VTVLQASGILPEYADIFCQFNFLHRHDEAFSTEPLKNNGRGSPLAFYHVQNIAVEITESFVDYIKTKPIV   1121 - 1190
FEVFGHYQQHPLHLQGQELNSPPQPCRRFFPPPMPLSKPVPATKLNTMSKTSLGQSMSKYDLLVWFEISE   1191 - 1260
LEPTGEYIPAVVDHTAGLPCQGTFLLHQGIQRRITVTIIHEKGSELHWKDVRELVVGRIRNKPEVDEAAV   1261 - 1330
DAILSLNIISAKYLKSSHNSSRTFYRFEAVWDSSLHNSLLLNRVTPYGEKIYMTLSAYLELDHCIQPAVI   1331 - 1400
TKDVCMVFYSRDAKISPPRSLRSLFGSGYSKSPDSNRVTGIYELSLCKMSDTGSPGMQRRRRKILDTSVA   1401 - 1470
YVRGEENLAGWRPRGDSLILEHQWELEKLELLHEVEKTRHFLLLRERLGDSIPKSLSDSLSPSLSSGTLS   1471 - 1540
TSTSISSQISTTTFESAITPSESSGYDSGDIESLVDREKELATKCLQLLTHTFNREFSQVHGSVSDCKLS   1541 - 1610
DISPIGRDPSESSFSSATLTPSSTCPSLVDSRSNSLDQKTPEANSRASSPCPEFEQFQIVPAVETPYLAR   1611 - 1680
AGKNEFLNLVPDIEEIRPSSVVSKKGYLHFKEPLYSNWAKHFVVVRRPYVFIYNSDKDPVERGIINLSTA   1681 - 1750
QVEYSEDQQAMVKTPNTFAVCTKHRGVLLQALNDKDMNDWLYAFNPLLAGTIRSKLSRRCPSQSKY       1751 - 1816
//

Text Mined References (77)

PMID Year Title