Property Summary

NCBI Gene PubMed Count 38
Grant Count 8
R01 Count 8
Funding $1,404,782
PubMed Score 15.56
PubTator Score 13.81

Knowledge Summary

Patent (635)

Expression

  Differential Expression (6)

Disease log2 FC p
psoriasis -2.100 0.000
osteosarcoma -1.118 0.001
posterior fossa group B ependymoma -1.700 0.000
glioblastoma -1.100 0.000
group 3 medulloblastoma -1.400 0.002
atypical teratoid/rhabdoid tumor -1.200 0.000

Synonym

Accession O60331 B7Z9E7 C6GIJ7 C6GIJ8 Q7LE07 PIP5K1-gamma
Symbols LCCS3
PIP5Kgamma
PIP5K-GAMMA
PIP5K1-gamma

Gene

PANTHER Protein Class (2)

PDB

2G35   3H1Z   3H85  

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

Gene RIF (28)

PMID Text
26916822 PIPKIgamma and INPP5E localize to the centrosome and coordinate the initiation of ciliogenesis.
26149501 results suggested that Akt-mediated PIP5Kgamma90 S555 phosphorylation is a novel regulatory point for talin binding to control PIP2 level at the FAs, thereby modulating FA dynamics and cell motility.
26070568 Loss of PIPKIgamma or its focal adhesion-targeting variant, PIPKIgammai2, impaired PI3K/Akt activation upon stimulation with growth factors or extracellular matrix proteins in different tumor cells.
24434581 PIPKIgamma binds to the cryptic polo-box domain of PLK4 and reduces the kinase activity of PLK4.
24151076 This study uncovers a novel mechanism where a phosphoinositide-synthesizing enzyme, PIPKIgammai2, functions with the proto-oncogene Src, to regulate oncogenic signaling
22049025 PIPKIgamma and phosphatidyl inositol phosphate pools at nascent E-cadherin contacts cue Exo70 targeting and orient the tethering of exocyst-associated E-cadherin
21931851 PIPKIgamma positively regulates focal adhesion dynamics and cancer invasion, most probably through PIP-mediated vinculin activation.
21303971 A novel mechanism in which PIPKIgamma expression and catalytic activity enhance beta-catenin nuclear translocation and expression of its target genes to promote tumorigenic phenotypes.
21216957 EZH2 regulates neuronal differentiation of mesenchymal stem cells through PIP5K1C-dependent calcium signaling.
20668706 SIRT1 deacetylated two specific lysine residues (K265/K268) in PIP5Kgamma and enhanced PIP5Kgamma enzyme activity.
More...

AA Sequence

MELEVPDEAESAEAGAVPSEAAWAAESGAAAGLAQKKAAPTEVLSMTAQPGPGHGKKLGHRGVDASGETT      1 - 70
YKKTTSSTLKGAIQLGIGYTVGHLSSKPERDVLMQDFYVVESIFFPSEGSNLTPAHHFQDFRFKTYAPVA     71 - 140
FRYFRELFGIRPDDYLYSLCNEPLIELSNPGASGSLFYVTSDDEFIIKTVMHKEAEFLQKLLPGYYMNLN    141 - 210
QNPRTLLPKFYGLYCVQSGGKNIRVVVMNNILPRVVKMHLKFDLKGSTYKRRASKKEKEKSFPTYKDLDF    211 - 280
MQDMPEGLLLDADTFSALVKTLQRDCLVLESFKIMDYSLLLGVHNIDQHERERQAQGAQSTSDEKRPVGQ    281 - 350
KALYSTAMESIQGGAARGEAIESDDTMGGIPAVNGRGERLLLHIGIIDILQSYRFIKKLEHTWKALVHDG    351 - 420
DTVSVHRPSFYAERFFKFMSNTVFRKNSSLKSSPSKKGRGGALLAVKPLGPTAAFSASQIPSEREEAQYD    421 - 490
LRGARSYPTLEDEGRPDLLPCTPPSFEEATTASIATTLSSTSLSIPERSPSETSEQPRYRRRTQSSGQDG    491 - 560
RPQEEPPAEEDLQQITVQVEPACSVEIVVPKEEDAGVEASPAGASAAVEVETASQASDEEGAPASQASDE    561 - 630
EDAPATDIYFPTDERSWVYSPLHYSAQAPPASDGESDT                                    631 - 668
//

Text Mined References (40)

PMID Year Title
27365365 2016 Diverse alternative back-splicing and alternative splicing landscape of circular RNAs.
26916822 2016 Phosphatidylinositol phosphate kinase PIPKI? and phosphatase INPP5E coordinate initiation of ciliogenesis.
26149501 2015 Phosphorylation of phosphatidylinositol 4-phosphate 5-kinase ? by Akt regulates its interaction with talin and focal adhesion dynamics.
26070568 2015 Phosphatidylinositol Phosphate 5-Kinase I? and Phosphoinositide 3-Kinase/Akt Signaling Couple to Promote Oncogenic Growth.
24434581 2014 PIPKI? targets to the centrosome and restrains centriole duplication.
24151076 2013 Phosphatidylinositol phosphate 5-kinase I?i2 in association with Src controls anchorage-independent growth of tumor cells.
23982733 2013 IQGAP1 is a novel phosphatidylinositol 4,5 bisphosphate effector in regulation of directional cell migration.
22049025 2012 An association between type I? PI4P 5-kinase and Exo70 directs E-cadherin clustering and epithelial polarization.
21931851 2011 PIPKI? regulates focal adhesion dynamics and colon cancer cell invasion.
21303971 2011 PIPKI? regulates ?-catenin transcriptional activity downstream of growth factor receptor signaling.
More...