Property Summary

Ligand Count 1
NCBI Gene PubMed Count 42
PubMed Score 17.02
PubTator Score 13.81

Knowledge Summary

Patent (635)

Expression

  Differential Expression (6)

Disease log2 FC p
atypical teratoid/rhabdoid tumor -1.200 6.8e-07
ependymoma -1.400 1.4e-11
glioblastoma -1.100 1.2e-07
group 3 medulloblastoma -1.400 1.7e-03
osteosarcoma -1.118 7.3e-04
psoriasis -2.100 4.6e-05

Protein-protein Interaction (1)

Gene RIF (31)

AA Sequence

MELEVPDEAESAEAGAVPSEAAWAAESGAAAGLAQKKAAPTEVLSMTAQPGPGHGKKLGHRGVDASGETT      1 - 70
YKKTTSSTLKGAIQLGIGYTVGHLSSKPERDVLMQDFYVVESIFFPSEGSNLTPAHHFQDFRFKTYAPVA     71 - 140
FRYFRELFGIRPDDYLYSLCNEPLIELSNPGASGSLFYVTSDDEFIIKTVMHKEAEFLQKLLPGYYMNLN    141 - 210
QNPRTLLPKFYGLYCVQSGGKNIRVVVMNNILPRVVKMHLKFDLKGSTYKRRASKKEKEKSFPTYKDLDF    211 - 280
MQDMPEGLLLDADTFSALVKTLQRDCLVLESFKIMDYSLLLGVHNIDQHERERQAQGAQSTSDEKRPVGQ    281 - 350
KALYSTAMESIQGGAARGEAIESDDTMGGIPAVNGRGERLLLHIGIIDILQSYRFIKKLEHTWKALVHDG    351 - 420
DTVSVHRPSFYAERFFKFMSNTVFRKNSSLKSSPSKKGRGGALLAVKPLGPTAAFSASQIPSEREEAQYD    421 - 490
LRGARSYPTLEDEGRPDLLPCTPPSFEEATTASIATTLSSTSLSIPERSPSETSEQPRYRRRTQSSGQDG    491 - 560
RPQEEPPAEEDLQQITVQVEPACSVEIVVPKEEDAGVEASPAGASAAVEVETASQASDEEGAPASQASDE    561 - 630
EDAPATDIYFPTDERSWVYSPLHYSAQAPPASDGESDT                                    631 - 668
//

Text Mined References (44)

PMID Year Title