Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.69
PubTator Score 0.15

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
active Crohn's disease -1.951 1.7e-02
active ulcerative colitis -1.607 6.9e-03
adult high grade glioma -2.200 2.7e-05
astrocytic glioma -1.100 4.6e-03
Astrocytoma, Pilocytic -2.000 2.5e-06
atypical teratoid / rhabdoid tumor -1.700 6.6e-04
glioblastoma -2.200 8.7e-09
group 3 medulloblastoma -2.900 6.5e-05
lung adenocarcinoma -1.400 1.2e-10
lung cancer 1.300 1.7e-02
malignant mesothelioma 3.600 8.0e-09
medulloblastoma, large-cell -3.100 4.0e-05
oligodendroglioma -1.600 5.2e-19
primitive neuroectodermal tumor -1.700 2.2e-02
psoriasis -1.100 7.7e-18

Gene RIF (3)

AA Sequence

MPPAGGPRAPRPAALPRSLSRLRECPGRSRIVLALGATQMALGCLIVAVSFAALALTTSARVRHSCPFWA      1 - 70
GFSVLLSGLIGVVSWKRPLSLVITFFMLLSAVCVMLNLAGSILSCQNAQLVNSLEGCQLIKFDSVEVCVC     71 - 140
CELQHQSSGCSNLGETLKLNPLQENCNAVRLTLKDLLFSVCALNVLSTIVCALATAMCCMQMVSSDVLQM    141 - 210
FLPQRSHPANPTCVTPHGTVLHQTLDFDEFIPPLPPPPYYPPEYTCTPSTEAQRGLHLDFAPSPFGTLYD    211 - 280
VAINSPGLLYPAELPPPYEAVVGQPPASQVTSIGQQVAESSSGDPNTSAGFSTPVPADSTSLLVSEGTAT    281 - 350
PGSSPSPDGPVGAPAPSEPALPPGHVSPEDPGMGSQVQPGPGRVSRSTSDPTLCTSSMAGDASSHRPSCS    351 - 420
QDLEAGLSEAVPGSASMSRSATAACRAQLSPAGDPDTWKTDQRPTPEPFPATSKERPRSLVDSKAYADAR    421 - 490
VLVAKFLEHSHCALPTEAQHMVGAMRLAVTNEERLEEEAVFGADVLDQV                         491 - 539
//

Text Mined References (10)

PMID Year Title