Property Summary

NCBI Gene PubMed Count 33
PubMed Score 58.03
PubTator Score 40.10

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
osteosarcoma 2.081 0.000
ependymoma 1.200 0.001
atypical teratoid / rhabdoid tumor 1.500 0.001
glioblastoma 1.900 0.009
group 4 medulloblastoma 1.700 0.001
medulloblastoma, large-cell 2.300 0.000
colon cancer 1.300 0.026
pediatric high grade glioma 1.400 0.010
aldosterone-producing adenoma -1.206 0.021
ovarian cancer 2.200 0.000
Gaucher disease type 1 -1.800 0.005

Synonym

Accession O60318 C9JL56 Q2M3C1 Q6PJP6 Q9BSY5 Q9UMT4 GANP
Symbols GANP
SAC3
MAP80

Gene

PDB

4DHX  

Gene RIF (18)

PMID Text
26749495 These results indicated that the GANP protein is associated with breast cancer resistance.
24198285 GANP is induced in activated T4 cells & physically interacts with A3G. GANP is encapsidated in HIV-1 virions & modulates A3G packaging into the cores. Upregulation increases A3G-catalyzed viral G-->A hypermutation, suppressing infectivity.
24198285 Encapsidation of GANP into virions requires the CA region of HIV-1 Gag and GANP and is associated with HIV-1 genomic RNA
24123876 A homozygous potentially pathogenic variant (c.2743G>A) was identified, which encodes amino acid Lys, instead of conserved Glu, at the position 915, in patients with mild intellectual disability.
23652018 GANP-mediated chromatin modification promotes transcription complex recruitment and positioning at immunoglobulin variable loci to favour AID targeting.
23094019 The cellular protein MCM3AP is required for inhibition of cellular DNA synthesis by the IE86 protein of human cytomegalovirus.
22942428 GANP transgene may play a critical role in Lyn tyrosine-protein kinase-mediated signaling during selection of high-affinity B cells in peripheral lymphoid organs.
22395445 GANP, a homologue of yeast Sac3 that is involved in mRNA export, is indispensable for ensuring the stability of human genomic DNA and GANP knockdown causes apoptosis and necrosis of p53-insufficient cancer cells.
21195085 MCM3AP and GANP are different proteins, occupying different locations in the cell and transcribed from different promoters
20714864 HBV DNA integration sites into human genome were random, and MCM3AP was a new site.
More...

AA Sequence

MNPTNPFSGQQPSAFSASSSNVGTLPSKPPFRFGQPSLFGQNSTLSGKSSGFSQVSSFPASSGVSHSSSV      1 - 70
QTLGFTQTSSVGPFSGLEHTSTFVATSGPSSSSVLGNTGFSFKSPTSVGAFPSTSAFGQEAGEIVNSGFG     71 - 140
KTEFSFKPLENAVFKPILGAESEPEKTQSQIASGFFTFSHPISSAPGGLAPFSFPQVTSSSATTSNFTFS    141 - 210
KPVSSNNSLSAFTPALSNQNVEEEKRGPKSIFGSSNNSFSSFPVSSAVLGEPFQASKAGVRQGCEEAVSQ    211 - 280
VEPLPSLMKGLKRKEDQDRSPRRHGHEPAEDSDPLSRGDHPPDKRPVRLNRPRGGTLFGRTIQDVFKSNK    281 - 350
EVGRLGNKEAKKETGFVESAESDHMAIPGGNQSVLAPSRIPGVNKEEETESREKKEDSLRGTPARQSNRS    351 - 420
ESTDSLGGLSPSEVTAIQCKNIPDYLNDRTILENHFGKIAKVQRIFTRRSKKLAVVHFFDHASAALARKK    421 - 490
GKSLHKDMAIFWHRKKISPNKKPFSLKEKKPGDGEVSPSTEDAPFQHSPLGKAAGRTGASSLLNKSSPVK    491 - 560
KPSLLKAHQFEGDSFDSASEGSEGLGPCVLSLSTLIGTVAETSKEKYRLLDQRDRIMRQARVKRTDLDKA    561 - 630
RTFVGTCLDMCPEKERYMRETRSQLSVFEVVPGTDQVDHAAAVKEYSRSSADQEEPLPHELRPLPVLSRT    631 - 700
MDYLVTQIMDQKEGSLRDWYDFVWNRTRGIRKDITQQHLCDPLTVSLIEKCTRFHIHCAHFMCEEPMSSF    701 - 770
DAKINNENMTKCLQSLKEMYQDLRNKGVFCASEAEFQGYNVLLSLNKGDILREVQQFHPAVRNSSEVKFA    771 - 840
VQAFAALNSNNFVRFFKLVQSASYLNACLLHCYFSQIRKDALRALNFAYTVSTQRSTIFPLDGVVRMLLF    841 - 910
RDCEEATDFLTCHGLTVSDGCVELNRSAFLEPEGLSKTRKSVFITRKLTVSVGEIVNGGPLPPVPRHTPV    911 - 980
CSFNSQNKYIGESLAAELPVSTQRPGSDTVGGGRGEECGVEPDAPLSSLPQSLPAPAPSPVPLPPVLALT    981 - 1050
PSVAPSLFQLSVQPEPPPPEPVPMYSDEDLAQVVDELIQEALQRDCEEVGSAGAAYAAAALGVSNAAMED   1051 - 1120
LLTAATTGILRHIAAEEVSKERERREQERQRAEEERLKQERELVLSELSQGLAVELMERVMMEFVRETCS   1121 - 1190
QELKNAVETDQRVRVARCCEDVCAHLVDLFLVEEIFQTAKETLQELQCFCKYLQRWREAVTARKKLRRQM   1191 - 1260
RAFPAAPCCVDVSDRLRALAPSAECPIAEENLARGLLDLGHAGRLGISCTRLRRLRNKTAHQMKVQHFYQ   1261 - 1330
QLLSDVAWASLDLPSLVAEHLPGRQEHVFWKLVLVLPDVEEQSPESCGRILANWLKVKFMGDEGSVDDTS   1331 - 1400
SDAGGIQTLSLFNSLSSKGDQMISVNVCIKVAHGALSDGAIDAVETQKDLLGASGLMLLLPPKMKSEDMA   1401 - 1470
EEDVYWLSALLQLKQLLQAKPFQPALPLVVLVPSPGGDAVEKEVEDGLMLQDLVSAKLISDYTVTEIPDT   1471 - 1540
INDLQGSTKVLQAVQWLVSHCPHSLDLCCQTLIQYVEDGIGHEFSGRFFHDRRERRLGGLASQEPGAIIE   1541 - 1610
LFNSVLQFLASVVSSEQLCDLSWPVTEFAEAGGSRLLPHLHWNAPEHLAWLKQAVLGFQLPQMDLPPLGA   1611 - 1680
PWLPVCSMVVQYASQIPSSRQTQPVLQSQVENLLHRTYCRWKSKSPSPVHGAGPSVMEIPWDDLIALCIN   1681 - 1750
HKLRDWTPPRLPVTSEALSEDGQICVYFFKNDLKKYDVPLSWEQARLQTQKELQLREGRLAIKPFHPSAN   1751 - 1820
NFPIPLLHMHRNWKRSTECAQEGRIPSTEDLMRGASAEELLAQCLSSSLLLEKEENKRFEDQLQQWLSED   1821 - 1890
SGAFTDLTSLPLYLPQTLVSLSHTIEPVMKTSVTTSPQSDMMREQLQLSEATGTCLGERLKHLERLIRSS   1891 - 1960
REEEVASELHLSALLDMVDI                                                     1961 - 1980
//

Text Mined References (41)

PMID Year Title
26749495 2016 GANP protein encoded on human chromosome 21/mouse chromosome 10 is associated with resistance to mammary tumor development.
24198285 2013 GANP interacts with APOBEC3G and facilitates its encapsidation into the virions to reduce HIV-1 infectivity.
24123876 2013 Identification of pathogenic gene variants in small families with intellectually disabled siblings by exome sequencing.
23666240 2013 Identification of nine new susceptibility loci for testicular cancer, including variants near DAZL and PRDM14.
23652018 2013 GANP regulates recruitment of AID to immunoglobulin variable regions by modulating transcription and nucleosome occupancy.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23094019 2012 The cellular protein MCM3AP is required for inhibition of cellular DNA synthesis by the IE86 protein of human cytomegalovirus.
22942428 2012 Lyn signaling to upregulate GANP is critical for the survival of high-affinity B cells in germinal centers of lymphoid organs.
22395445 2012 Selective cell death of p53-insufficient cancer cells is induced by knockdown of the mRNA export molecule GANP.
22307388 2012 Functional and structural characterization of the mammalian TREX-2 complex that links transcription with nuclear messenger RNA export.
More...