Property Summary

NCBI Gene PubMed Count 23
Grant Count 4
R01 Count 4
Funding $179,486.99
PubMed Score 17.17
PubTator Score 14.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
cutaneous lupus erythematosus 1.200 0.003
psoriasis -1.400 0.000
osteosarcoma 1.151 0.000
cystic fibrosis -1.859 0.000
medulloblastoma, large-cell -1.500 0.000
adrenocortical carcinoma -1.815 0.000
non-small cell lung cancer -1.457 0.000
lung cancer -2.600 0.000
active Crohn's disease 1.250 0.006
posterior fossa group B ependymoma 1.300 0.000
non primary Sjogren syndrome sicca 1.100 0.003
lung adenocarcinoma -1.300 0.000
lung carcinoma -1.400 0.000
ovarian cancer 1.300 0.010

Synonym

Accession O60312 Q4G0S9 Q969I4
Symbols ATPVA
ATPVC
ATP10C

Gene

PANTHER Protein Class (2)

Gene RIF (12)

PMID Text
25947375 results suggest that enhanced PC flipping activity due to exogenous ATP10A expression alters the lipid composition at the plasma membrane
21209057 has been proven that hypocaloric diets induce changes in the DNA methylation pattern in PBMCs (CpG18 of ATP10A and CpG 21 of WT1) and that some of these markers could be used as early indicators of response to metabolic effects of weight-loss programs
20609483 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20198315 Observational study of gene-disease association. (HuGE Navigator)
19851296 Observational study of gene-disease association. (HuGE Navigator)
19086053 Observational study of gene-disease association. (HuGE Navigator)
18726118 monoallelic expression of human ATP10A is variable in the population and is influenced by both gender and common genetic variation
18186074 In the analysis of a four-marker haplotype located in ATP10C, a statistically significant difference was observed in the frequency of one haplotype between male autism patients and controls
18186074 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MEREPAGTEEPGPPGRRRRREGRTRTVRSNLLPPPGAEDPAAGAAKGERRRRRGCAQHLADNRLKTTKYT      1 - 70
LLSFLPKNLFEQFHRPANVYFVFIALLNFVPAVNAFQPGLALAPVLFILAITAFRDLWEDYSRHRSDHKI     71 - 140
NHLGCLVFSREEKKYVNRFWKEIHVGDFVRLRCNEIFPADILLLSSSDPDGLCHIETANLDGETNLKRRQ    141 - 210
VVRGFSELVSEFNPLTFTSVIECEKPNNDLSRFRGCIIHDNGKKAGLYKENLLLRGCTLRNTDAVVGIVI    211 - 280
YAGHETKALLNNSGPRYKRSKLERQMNCDVLWCVLLLVCMSLFSAVGHGLWIWRYQEKKSLFYVPKSDGS    281 - 350
SLSPVTAAVYSFLTMIIVLQVLIPISLYVSIEIVKACQVYFINQDMQLYDEETDSQLQCRALNITEDLGQ    351 - 420
IQYIFSDKTGTLTENKMVFRRCTVSGVEYSHDANAQRLARYQEADSEEEEVVPRGGSVSQRGSIGSHQSV    421 - 490
RVVHRTQSTKSHRRTGSRAEAKRASMLSKHTAFSSPMEKDITPDPKLLEKVSECDKSLAVARHQEHLLAH    491 - 560
LSPELSDVFDFFIALTICNTVVVTSPDQPRTKVRVRFELKSPVKTIEDFLRRFTPSCLTSGCSSIGSLAA    561 - 630
NKSSHKLGSSFPSTPSSDGMLLRLEERLGQPTSAIASNGYSSQADNWASELAQEQESERELRYEAESPDE    631 - 700
AALVYAARAYNCVLVERLHDQVSVELPHLGRLTFELLHTLGFDSVRKRMSVVIRHPLTDEINVYTKGADS    701 - 770
VVMDLLQPCSSVDARGRHQKKIRSKTQNYLNVYAAEGLRTLCIAKRVLSKEEYACWLQSHLEAESSLENS    771 - 840
EELLFQSAIRLETNLHLLGATGIEDRLQDGVPETISKLRQAGLQIWVLTGDKQETAVNIAYACKLLDHDE    841 - 910
EVITLNATSQEACAALLDQCLCYVQSRGLQRAPEKTKGKVSMRFSSLCPPSTSTASGRRPSLVIDGRSLA    911 - 980
YALEKNLEDKFLFLAKQCRSVLCCRSTPLQKSMVVKLVRSKLKAMTLAIGDGANDVSMIQVADVGVGISG    981 - 1050
QEGMQAVMASDFAVPKFRYLERLLILHGHWCYSRLANMVLYFFYKNTMFVGLLFWFQFFCGFSASTMIDQ   1051 - 1120
WYLIFFNLLFSSLPPLVTGVLDRDVPANVLLTNPQLYKSGQNMEEYRPRTFWFNMADAAFQSLVCFSIPY   1121 - 1190
LAYYDSNVDLFTWGTPIVTIALLTFLLHLGIETKTWTWLNWITCGFSVLLFFTVALIYNASCATCYPPSN   1191 - 1260
PYWTMQALLGDPVFYLTCLMTPVAALLPRLFFRSLQGRVFPTQLQLARQLTRKSPRRCSAPKETFAQGRL   1261 - 1330
PKDSGTEHSSGRTVKTSVPLSQPSWHTQQPVCSLEASGEPSTVDMSMPVREHTLLEGLSAPAPMSSAPGE   1331 - 1400
AVLRSPGGCPEESKVRAASTGRVTPLSSLFSLPTFSLLNWISSWSLVSRLGSVLQFSRTEQLADGQAGRG   1401 - 1470
LPVQPHSGRSGLQGPDHRLLIGASSRRSQ                                            1471 - 1499
//

Text Mined References (24)

PMID Year Title
25947375 2015 Phospholipid Flippase ATP10A Translocates Phosphatidylcholine and Is Involved in Plasma Membrane Dynamics.
22610502 2012 Genome-wide analysis of polymorphisms associated with cytokine responses in smallpox vaccine recipients.
21914794 2011 ATP9B, a P4-ATPase (a putative aminophospholipid translocase), localizes to the trans-Golgi network in a CDC50 protein-independent manner.
21901158 2011 Genome-wide detection of allele specific copy number variation associated with insulin resistance in African Americans from the HyperGEN study.
21209057 2011 A dual epigenomic approach for the search of obesity biomarkers: DNA methylation in relation to diet-induced weight loss.
20609483 2011 Role of UBE3A and ATP10A genes in autism susceptibility region 15q11-q13 in an Italian population: a positive replication for UBE3A.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20198315 2010 Association of genetic variants with hemorrhagic stroke in Japanese individuals.
19851296 2010 Assessment of a polymorphism of SDK1 with hypertension in Japanese Individuals.
19086053 2009 Identification of new putative susceptibility genes for several psychiatric disorders by association analysis of regulatory and non-synonymous SNPs of 306 genes involved in neurotransmission and neurodevelopment.
More...