Property Summary

NCBI Gene PubMed Count 22
PubMed Score 11.39
PubTator Score 11.80

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
Rheumatoid Arthritis 1.200 0.001
psoriasis -1.200 0.000
osteosarcoma -1.371 0.001
atypical teratoid/rhabdoid tumor -1.200 0.001
lung adenocarcinoma -1.100 0.000
subependymal giant cell astrocytoma 1.291 0.014
Pick disease 1.400 0.000
mucosa-associated lymphoid tissue lympho... 1.268 0.036
ulcerative colitis -1.200 0.000
ovarian cancer -2.200 0.000

Synonym

Accession O60296 E7EV21 Q8WVH7 Q96NS2 Q9C0K5 Q9C0K6
Symbols GRIF1
MILT2
OIP98
CALS-C
GRIF-1
ALS2CR3

Gene

PANTHER Protein Class (1)

Gene RIF (10)

PMID Text
26658612 Full-length APC promotes assembly of the Miro-1/Milton-2 complex.
25653102 This study showed that the TRAK2 was more prevalent in dendrites of hippocampal neurons. In cortical neurons, TRAK2 was equally distributed between axons and dendrites.
23395375 The results of this study established a key role for mammalian TRAK2 proteins in axonal and dendritic targeting of mitochondria.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19103291 These data suggest that Miro1 and the kinesin adaptor Grif-1 play an important role in regulating mitochondrial transport in neurons.
16895905 Binds to Kir2.1 and facilitates trafficking of this channel to the cell surface.
16835241 analysis of the GRIF-1 binding domain of the kinesin, KIF5C, which substantiates a role for GRIF-1 as an adaptor protein in the anterograde trafficking of cargoes
15644324 GRIF-1 and OIP106 have roles in protein and/or organelle transport in excitable cells in a manner analogous to glutamate receptor-interacting-protein 1
12034717 identification, molecular cloning and characterization

AA Sequence

MSQSQNAIFTSPTGEENLMNSNHRDSESITDVCSNEDLPEVELVSLLEEQLPQYRLKVDTLFLYENQDWT      1 - 70
QSPHQRQHASDALSPVLAEETFRYMILGTDRVEQMTKTYNDIDMVTHLLAERDRDLELAARIGQALLKRN     71 - 140
HVLSEQNESLEEQLGQAFDQVNQLQHELCKKDELLRIVSIASEESETDSSCSTPLRFNESFSLSQGLLQL    141 - 210
EMLQEKLKELEEENMALRSKACHIKTETVTYEEKEQQLVSDCVKELRETNAQMSRMTEELSGKSDELIRY    211 - 280
QEELSSLLSQIVDLQHKLKEHVIEKEELKLHLQASKDAQRQLTMELHELQDRNMECLGMLHESQEEIKEL    281 - 350
RSRSGPTAHLYFSQSYGAFTGESLAAEIEGTMRKKLSLDEESSLFKQKAQQKRVFDTVRIANDTRGRSIS    351 - 420
FPALLPIPGSNRSSVIMTAKPFESGLQQTEDKSLLNQGSSSEEVAGSSQKMGQPGPSGDSDLATALHRLS    421 - 490
LRRQNYLSEKQFFAEEWQRKIQVLADQKEGVSGCVTPTESLASLCTTQSEITDLSSASCLRGFMPEKLQI    491 - 560
VKPLEGSQTLYHWQQLAQPNLGTILDPRPGVITKGFTQLPGDAIYHISDLEEDEEEGITFQVQQPLEVEE    561 - 630
KLSTSKPVTGIFLPPITSAGGPVTVATANPGKCLSCTNSTFTFTTCRILHPSDITQVTPSSGFPSLSCGS    631 - 700
SGSSSSNTAVNSPALSYRLSIGESITNRRDSTTTFSSTMSLAKLLQERGISAKVYHSPISENPLQPLPKS    701 - 770
LAIPSTPPNSPSHSPCPSPLPFEPRVHLSENFLASRPAETFLQEMYGLRPSRNPPDVGQLKMNLVDRLKR    771 - 840
LGIARVVKNPGAQENGRCQEAEIGPQKPDSAVYLNSGSSLLGGLRRNQSLPVIMGSFAAPVCTSSPKMGV    841 - 910
LKED                                                                      911 - 914
//

Text Mined References (25)

PMID Year Title
26658612 2016 APC binds the Miro/Milton motor complex to stimulate transport of mitochondria to the plasma membrane.
25653102 2015 Localization of the kinesin adaptor proteins trafficking kinesin proteins 1 and 2 in primary cultures of hippocampal pyramidal and cortical neurons.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23395375 2013 TRAK/Milton motor-adaptor proteins steer mitochondrial trafficking to axons and dendrites.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20230862 2010 Human Miltons associate with mitochondria and induce microtubule-dependent remodeling of mitochondrial networks.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19103291 2009 GTPase dependent recruitment of Grif-1 by Miro1 regulates mitochondrial trafficking in hippocampal neurons.
16895905 2006 Identification of gamma-aminobutyric acid receptor-interacting factor 1 (TRAK2) as a trafficking factor for the K+ channel Kir2.1.
More...