Property Summary

NCBI Gene PubMed Count 22
PubMed Score 13.04
PubTator Score 11.80

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (10)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.100 5.1e-03
lung adenocarcinoma -1.100 3.7e-17
mucosa-associated lymphoid tissue lympho... 1.268 3.6e-02
osteosarcoma -1.371 6.0e-04
ovarian cancer -1.900 8.1e-06
Pick disease 1.400 2.7e-04
psoriasis -1.100 1.0e-06
Rheumatoid arthritis 1.200 9.5e-04
subependymal giant cell astrocytoma 1.291 1.4e-02
ulcerative colitis -1.100 2.2e-06

Gene RIF (10)

AA Sequence

MSQSQNAIFTSPTGEENLMNSNHRDSESITDVCSNEDLPEVELVSLLEEQLPQYRLKVDTLFLYENQDWT      1 - 70
QSPHQRQHASDALSPVLAEETFRYMILGTDRVEQMTKTYNDIDMVTHLLAERDRDLELAARIGQALLKRN     71 - 140
HVLSEQNESLEEQLGQAFDQVNQLQHELCKKDELLRIVSIASEESETDSSCSTPLRFNESFSLSQGLLQL    141 - 210
EMLQEKLKELEEENMALRSKACHIKTETVTYEEKEQQLVSDCVKELRETNAQMSRMTEELSGKSDELIRY    211 - 280
QEELSSLLSQIVDLQHKLKEHVIEKEELKLHLQASKDAQRQLTMELHELQDRNMECLGMLHESQEEIKEL    281 - 350
RSRSGPTAHLYFSQSYGAFTGESLAAEIEGTMRKKLSLDEESSLFKQKAQQKRVFDTVRIANDTRGRSIS    351 - 420
FPALLPIPGSNRSSVIMTAKPFESGLQQTEDKSLLNQGSSSEEVAGSSQKMGQPGPSGDSDLATALHRLS    421 - 490
LRRQNYLSEKQFFAEEWQRKIQVLADQKEGVSGCVTPTESLASLCTTQSEITDLSSASCLRGFMPEKLQI    491 - 560
VKPLEGSQTLYHWQQLAQPNLGTILDPRPGVITKGFTQLPGDAIYHISDLEEDEEEGITFQVQQPLEVEE    561 - 630
KLSTSKPVTGIFLPPITSAGGPVTVATANPGKCLSCTNSTFTFTTCRILHPSDITQVTPSSGFPSLSCGS    631 - 700
SGSSSSNTAVNSPALSYRLSIGESITNRRDSTTTFSSTMSLAKLLQERGISAKVYHSPISENPLQPLPKS    701 - 770
LAIPSTPPNSPSHSPCPSPLPFEPRVHLSENFLASRPAETFLQEMYGLRPSRNPPDVGQLKMNLVDRLKR    771 - 840
LGIARVVKNPGAQENGRCQEAEIGPQKPDSAVYLNSGSSLLGGLRRNQSLPVIMGSFAAPVCTSSPKMGV    841 - 910
LKED                                                                      911 - 914
//

Text Mined References (25)

PMID Year Title