Property Summary

NCBI Gene PubMed Count 9
Grant Count 4
Funding $18,919.71
PubMed Score 84.86
PubTator Score 4.14

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
group 3 medulloblastoma 1.700 0.000
ovarian cancer -1.100 0.000

Gene RIF (6)

PMID Text
22253232 Kr-pok interacted directly with the DNA binding and oligomerization domains of p53. This interaction was essential for Kr-pok to bind the distal promoter region of the CDKN1A gene, p21WAF1, and to inhibit p53-mediated transcriptional activation of CDKN1A.
19287006 This paper reports crystal structures of a yeast homolog, TYW4.
17026958 In conclusion, we report that the transcription factor Sp1 involved in the p38MAPK-mediated control of p21WAF1 regulation on VSMC in response to BITC has now been identified.
16830365 p21WAF1 and Bax may be used as the markers in the assessment of GIST malignant potential.
15813917 Inacativaton of this cell cycle regulatory genes by DNA methylation could be associated with tumorigenesis in NK cell disorders.
12485877 Cigarette smoke-induced oxidative stress and TGF-beta1 increase its expression in alveolar epithelial cells

AA Sequence

MGPRSRERRAGAVQNTNDSSALSKRSLAARGYVQDPFAALLVPGAARRAPLIHRGYYVRARAVRHCVRAF      1 - 70
LEQIGAPQAALRAQILSLGAGFDSLYFRLKTAGRLARAAVWEVDFPDVARRKAERIGETPELCALTGPFE     71 - 140
RGEPASALCFESADYCILGLDLRQLQRVEEALGAAGLDAASPTLLLAEAVLTYLEPESAAALIAWAAQRF    141 - 210
PNALFVVYEQMRPQDAFGQFMLQHFRQLNSPLHGLERFPDVEAQRRRFLQAGWTACGAVDMNEFYHCFLP    211 - 280
AEERRRVENIEPFDEFEEWHLKCAHYFILAASRGDTLSHTLVFPSSEAFPRVNPASPSGVFPASVVSSEG    281 - 350
QVPNLKRYGHASVFLSPDVILSAGGFGEQEGRHCRVSQFHLLSRDCDSEWKGSQIGSCGTGVQWDGRLYH    351 - 420
TMTRLSESRVLVLGGRLSPVSPALGVLQLHFFKSEDNNTEDLKVTITKAGRKDDSTLCCWRHSTTEVSCQ    421 - 490
NQEYLFVYGGRSVVEPVLSDWHFLHVGTMAWVRIPVEGEVPEARHSHSACTWQGGALIAGGLGASEEPLN    491 - 560
SVLFLRPISCGFLWESVDIQPPITPRYSHTAHVLNGKLLLVGGIWIHSSSFPGVTVINLTTGLSSEYQID    561 - 630
TTYVPWPLMLHNHTSILLPEEQQLLLLGGGGNCFSFGTYFNPHTVTLDLSSLSAGQ                  631 - 686
//

Text Mined References (10)

PMID Year Title
22253232 2012 KR-POK interacts with p53 and represses its ability to activate transcription of p21WAF1/CDKN1A.
19287006 2009 Structural basis of tRNA modification with CO2 fixation and methylation by wybutosine synthesizing enzyme TYW4.
17568008 2007 Independent and complementary methods for large-scale structural analysis of mammalian chromatin.
16642040 2006 Biosynthesis of wybutosine, a hyper-modified nucleoside in eukaryotic phenylalanine tRNA.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12853982 2003 p53RFP, a p53-inducible RING-finger protein, regulates the stability of p21WAF1.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10600115 1999 Purification of porcine brain protein phosphatase 2A leucine carboxyl methyltransferase and cloning of the human homologue.
9628581 1998 Prediction of the coding sequences of unidentified human genes. IX. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro.