Property Summary

NCBI Gene PubMed Count 20
Grant Count 9
R01 Count 5
Funding $655,474
PubMed Score 14.60
PubTator Score 8.61

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
psoriasis -1.700 0.000
osteosarcoma -1.152 0.001
astrocytoma 1.100 0.037
breast carcinoma 1.200 0.000
ovarian cancer -1.100 0.000

Gene RIF (7)

PMID Text
24556679 Mahogunin-mediated alpha-tubulin ubiquitination via noncanonical K6 linkage regulates microtubule stability and mitotic spindle orientation.
23756845 data suggest that MGRN1 selectively targets misfolded proteins for degradation and may exhibit viable therapeutic potential for the treatment of spongiform neurodegeneration
21862608 It therefore seems probable that the role of MGRN1 in the adrenal relates to the trafficking and/or degradation of the melanocortin 2 receptor.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19524515 Study shows that both (Ctm)PrP and cyPrP can interact with and disrupt the function of Mahogunin (Mgrn), a cytosolic ubiquitin ligase whose loss causes spongiform neurodegeneration.
19320733 Observational study of gene-disease association. (HuGE Navigator)
17229889 a role for Mahogunin in a proteasome-independent ubiquitylation pathway: TSG101 is a specific Mahogunin substrate

AA Sequence

MGSILSRRIAGVEDIDIQANSAYRYPPKSGNYFASHFFMGGEKFDTPHPEGYLFGENMDLNFLGSRPVQF      1 - 70
PYVTPAPHEPVKTLRSLVNIRKDSLRLVRYKDDADSPTEDGDKPRVLYSLEFTFDADARVAITIYCQASE     71 - 140
EFLNGRAVYSPKSPSLQSETVHYKRGVSQQFSLPSFKIDFSEWKDDELNFDLDRGVFPVVIQAVVDEGDV    141 - 210
VEVTGHAHVLLAAFEKHMDGSFSVKPLKQKQIVDRVSYLLQEIYGIENKNNQETKPSDDENSDNSNECVV    211 - 280
CLSDLRDTLILPCRHLCLCTSCADTLRYQANNCPICRLPFRALLQIRAVRKKPGALSPVSFSPVLAQSLE    281 - 350
HDEHSCPFKKSKPHPASLASKKPKRETNSDSVPPGYEPISLLEALNGLRAVSPAIPSAPLYEEITYSGIS    351 - 420
DGLSQASCPLAAIDHILDSSRQKGRPQSKAPDSTLRSPSSPIHEEDEEKLSEDVDAPPPLGGAELALRES    421 - 490
SSPESFITEEVDESSSPQQGTRAASIENVLQDSSPEHCGRGPPADIYLPALGPDSCSVGIDE            491 - 552
//

Text Mined References (27)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24556679 2014 Mahogunin-mediated ?-tubulin ubiquitination via noncanonical K6 linkage regulates microtubule stability and mitotic spindle orientation.
23756845 2013 Mahogunin ring finger-1 (MGRN1) suppresses chaperone-associated misfolded protein aggregation and toxicity.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21862608 2011 The E3 ubiquitin ligase Mahogunin ubiquitinates the melanocortin 2 receptor.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20213681 2010 Strategy for comprehensive identification of human N-myristoylated proteins using an insect cell-free protein synthesis system.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
More...