Property Summary

NCBI Gene PubMed Count 35
Grant Count 17
R01 Count 7
Funding $774,912.65
PubMed Score 33.48
PubTator Score 31.99

Knowledge Summary

Patent (3,399)

Expression

  Differential Expression (21)

Disease log2 FC p
malignant mesothelioma 1.200 0.000
astrocytic glioma -2.500 0.002
ependymoma -1.800 0.022
oligodendroglioma -2.000 0.016
glioblastoma -2.300 0.000
medulloblastoma -2.100 0.000
cystic fibrosis -2.100 0.000
atypical teratoid / rhabdoid tumor -1.900 0.000
medulloblastoma, large-cell -2.800 0.000
primitive neuroectodermal tumor -1.500 0.011
primary pancreatic ductal adenocarcinoma 1.347 0.007
lung cancer -1.500 0.001
pancreatic cancer 1.400 0.006
interstitial cystitis 1.200 0.000
adult high grade glioma -2.100 0.000
pilocytic astrocytoma -1.600 0.000
subependymal giant cell astrocytoma -2.024 0.045
invasive ductal carcinoma -1.800 0.002
nasopharyngeal carcinoma 1.100 0.000
ductal carcinoma in situ -1.200 0.015
ovarian cancer 2.100 0.002

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (26)

PMID Text
26255969 MiR-145 functions as a tumor suppressor targeting NUAK1 in human intrahepatic cholangiocarcinoma.
26151663 ARK5 was upregulated in ovarian cancer tissues, promoted epithelialmesenchymal transition and inhibited miR-1181 expression in ovarian cancer cells
25412236 Results indicate that NUAK1 is excessively expressed in NSCLC and plays important roles in NSCLC invasion.
25242509 Data indicate that miR-96 suppresses the expression of (nua) kinase family 1 (NUAK1) by targeting its 3' untranslated region (3' UTR).
24943992 Overexpression of NUAK1 is associated with disease-free survival and overall survival in patients with gastric cancer.
24785407 Expression of NUAK1 is controlled by cyclin-dependent kinase, PLK1, and the SCFbetaTrCP (Skp, Cullin and F-boxbetaTrCP) E3 ubiquitin ligase complex.
23934065 We demonstrate that miR-211 contributes to melanoma adhesion by directly targeting a gene, NUAK1.
23516026 Overexpression of ARK5 is associated with hepatocellular carcinoma.
23215946 High NUAK1 expression correlates with poor prognosis and involved in human nonsmall cell lung cancer cells migration and invasion.
23063350 ARK5 can promote glioma cell invasion by regulating cytoskeleton rearrangement and matrix metalloproteinase activation.
More...

AA Sequence

MEGAAAPVAGDRPDLGLGAPGSPREAVAGATAALEPRKPHGVKRHHHKHNLKHRYELQETLGKGTYGKVK      1 - 70
RATERFSGRVVAIKSIRKDKIKDEQDMVHIRREIEIMSSLNHPHIISIYEVFENKDKIVIIMEYASKGEL     71 - 140
YDYISERRRLSERETRHFFRQIVSAVHYCHKNGVVHRDLKLENILLDDNCNIKIADFGLSNLYQKDKFLQ    141 - 210
TFCGSPLYASPEIVNGRPYRGPEVDSWALGVLLYTLVYGTMPFDGFDHKNLIRQISSGEYREPTQPSDAR    211 - 280
GLIRWMLMVNPDRRATIEDIANHWWVNWGYKSSVCDCDALHDSESPLLARIIDWHHRSTGLQADTEAKMK    281 - 350
GLAKPTTSEVMLERQRSLKKSKKENDFAQSGQDAVPESPSKLSSKRPKGILKKRSNSEHRSHSTGFIEGV    351 - 420
VGPALPSTFKMEQDLCRTGVLLPSSPEAEVPGKLSPKQSATMPKKGILKKTQQRESGYYSSPERSESSEL    421 - 490
LDSNDVMGSSIPSPSPPDPARVTSHSLSCRRKGILKHSSKYSAGTMDPALVSPEMPTLESLSEPGVPAEG    491 - 560
LSRSYSRPSSVISDDSVLSSDSFDLLDLQENRPARQRIRSCVSAENFLQIQDFEGLQNRPRPQYLKRYRN    561 - 630
RLADSSFSLLTDMDDVTQVYKQALEICSKLN                                           631 - 661
//

Text Mined References (41)

PMID Year Title
26255969 2015 MiR-145 functions as a tumor suppressor targeting NUAK1 in human intrahepatic cholangiocarcinoma.
26151663 2015 Activation of ARK5/miR-1181/HOXA10 axis promotes epithelial-mesenchymal transition in ovarian cancer.
25412236 2014 MiR-204 inhibits human NSCLC metastasis through suppression of NUAK1.
25329316 2014 A mouse model uncovers LKB1 as an UVB-induced DNA damage sensor mediating CDKN1A (p21WAF1/CIP1) degradation.
25242509 2014 miR?96 functions as a tumor suppressor gene by targeting NUAK1 in pancreatic cancer.
24943992 2014 Overexpression of NUAK1 is associated with disease-free survival and overall survival in patients with gastric cancer.
24785407 2014 Interplay between Polo kinase, LKB1-activated NUAK1 kinase, PP1?MYPT1 phosphatase complex and the SCF?TrCP E3 ubiquitin ligase.
24709693 2014 Genome-wide data reveal novel genes for methotrexate response in a large cohort of juvenile idiopathic arthritis cases.
23934065 2014 Transcription factor/microRNA axis blocks melanoma invasion program by miR-211 targeting NUAK1.
23516026 2013 Overexpression of ARK5 is associated with poor prognosis in hepatocellular carcinoma.
More...