Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
malignant mesothelioma -2.600 0.000
psoriasis -1.300 0.008
glioblastoma multiforme -1.200 0.000
medulloblastoma -2.000 0.001
cystic fibrosis 1.616 0.000
medulloblastoma, large-cell -2.600 0.001
interstitial cystitis 1.900 0.011
pilocytic astrocytoma 2.600 0.000
subependymal giant cell astrocytoma 1.820 0.023
ovarian cancer -1.700 0.000

AA Sequence

MTAEGPSPPARWHRRLPGLWAAALLLLGLPRLSVRADGKFFVLESQNGSQGLQLEAARLSCKSRGAHLAS      1 - 70
ADELRRVVQDCSFAVCTTGWLADGTLGTTVCSKGSGEQQIMRAVDVRIESNPVPGGTYSALCIKDEEKPC     71 - 140
GDPPSFPHTILQGRTGLEMGDELLYVCAPGHIMGHRETAFTLLCNSCGEWYGLVQACGKDEAEAHIDYED    141 - 210
NFPDDRSVSFRELMEDSRTEADEDRGQGDSSEEAPKQDRLVSISVGRENIARDKVFVPTTGLPGAGSSVP    211 - 280
ADSPGSRLLQKHLFWFPAEAFHKPGLEKEVDDDTKKQFSAGDNHSGVKLVPGEPETKVIYGNTDGPSGPF    281 - 350
VGKNDSKAGDPVVSSSDESWLDGYPVTEGAWRKTEAEEEEDGDRGDGSVGLDENVLVTPDQPILVEVKKP    351 - 420
KSSTLTPSEGMTHSSVLPSQMLDVEALALRPVNASETEGIGDGDLTKYQSTLPWRFITEESPMATLSYEL    421 - 490
TSSTLEILTVNTVKQTPNHIPSTIMATTQPPVETTVPEIQDSFPYLLSEDFFGQEGPGPGASEELHPTLE    491 - 560
SCVGDGCPGLSRGPVIATIVTVLCLLLLLAGVGMVWGYRKCQHKSSVYKLNVGQRQARHYHQQIEMEKV     561 - 629
//

Text Mined References (3)

PMID Year Title
21269460 2011 Initial characterization of the human central proteome.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
9628581 1998 Prediction of the coding sequences of unidentified human genes. IX. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro.