Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
Astrocytoma, Pilocytic 2.600 6.0e-05
cystic fibrosis 1.616 4.5e-05
glioblastoma multiforme -1.200 2.7e-06
group 3 medulloblastoma -1.800 3.0e-02
interstitial cystitis 1.900 1.1e-02
malignant mesothelioma -2.600 6.3e-07
medulloblastoma, large-cell -2.600 6.8e-04
ovarian cancer -1.700 1.1e-08
psoriasis -1.300 7.8e-03
subependymal giant cell astrocytoma 1.820 2.3e-02

AA Sequence

MTAEGPSPPARWHRRLPGLWAAALLLLGLPRLSVRADGKFFVLESQNGSQGLQLEAARLSCKSRGAHLAS      1 - 70
ADELRRVVQDCSFAVCTTGWLADGTLGTTVCSKGSGEQQIMRAVDVRIESNPVPGGTYSALCIKDEEKPC     71 - 140
GDPPSFPHTILQGRTGLEMGDELLYVCAPGHIMGHRETAFTLLCNSCGEWYGLVQACGKDEAEAHIDYED    141 - 210
NFPDDRSVSFRELMEDSRTEADEDRGQGDSSEEAPKQDRLVSISVGRENIARDKVFVPTTGLPGAGSSVP    211 - 280
ADSPGSRLLQKHLFWFPAEAFHKPGLEKEVDDDTKKQFSAGDNHSGVKLVPGEPETKVIYGNTDGPSGPF    281 - 350
VGKNDSKAGDPVVSSSDESWLDGYPVTEGAWRKTEAEEEEDGDRGDGSVGLDENVLVTPDQPILVEVKKP    351 - 420
KSSTLTPSEGMTHSSVLPSQMLDVEALALRPVNASETEGIGDGDLTKYQSTLPWRFITEESPMATLSYEL    421 - 490
TSSTLEILTVNTVKQTPNHIPSTIMATTQPPVETTVPEIQDSFPYLLSEDFFGQEGPGPGASEELHPTLE    491 - 560
SCVGDGCPGLSRGPVIATIVTVLCLLLLLAGVGMVWGYRKCQHKSSVYKLNVGQRQARHYHQQIEMEKV     561 - 629
//

Text Mined References (3)

PMID Year Title