Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
ovarian cancer 8492 1.05195439575807E-8
malignant mesothelioma 3163 6.26529232898371E-7
glioblastoma multiforme 347 2.67555214129378E-6
cystic fibrosis 1670 4.45181165869535E-5
pilocytic astrocytoma 3086 5.43793473445443E-5
medulloblastoma, large-cell 6234 6.75348284819453E-4
medulloblastoma 1524 7.27507048134622E-4
psoriasis 6685 0.00782598803848477
interstitial cystitis 2299 0.0111377792758676
subependymal giant cell astrocytoma 2287 0.0228576810002318

Expression

  Differential Expression (10)

Disease log2 FC p
malignant mesothelioma -2.600 0.000
psoriasis -1.300 0.008
glioblastoma multiforme -1.200 0.000
medulloblastoma -2.000 0.001
cystic fibrosis 1.616 0.000
medulloblastoma, large-cell -2.600 0.001
interstitial cystitis 1.900 0.011
pilocytic astrocytoma 2.600 0.000
subependymal giant cell astrocytoma 1.820 0.023
ovarian cancer -1.700 0.000

Synonym

Accession O60279
Symbols

Gene

  Ortholog (7)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG

AA Sequence

MTAEGPSPPARWHRRLPGLWAAALLLLGLPRLSVRADGKFFVLESQNGSQGLQLEAARLSCKSRGAHLAS      1 - 70
ADELRRVVQDCSFAVCTTGWLADGTLGTTVCSKGSGEQQIMRAVDVRIESNPVPGGTYSALCIKDEEKPC     71 - 140
GDPPSFPHTILQGRTGLEMGDELLYVCAPGHIMGHRETAFTLLCNSCGEWYGLVQACGKDEAEAHIDYED    141 - 210
NFPDDRSVSFRELMEDSRTEADEDRGQGDSSEEAPKQDRLVSISVGRENIARDKVFVPTTGLPGAGSSVP    211 - 280
ADSPGSRLLQKHLFWFPAEAFHKPGLEKEVDDDTKKQFSAGDNHSGVKLVPGEPETKVIYGNTDGPSGPF    281 - 350
VGKNDSKAGDPVVSSSDESWLDGYPVTEGAWRKTEAEEEEDGDRGDGSVGLDENVLVTPDQPILVEVKKP    351 - 420
KSSTLTPSEGMTHSSVLPSQMLDVEALALRPVNASETEGIGDGDLTKYQSTLPWRFITEESPMATLSYEL    421 - 490
TSSTLEILTVNTVKQTPNHIPSTIMATTQPPVETTVPEIQDSFPYLLSEDFFGQEGPGPGASEELHPTLE    491 - 560
SCVGDGCPGLSRGPVIATIVTVLCLLLLLAGVGMVWGYRKCQHKSSVYKLNVGQRQARHYHQQIEMEKV     561 - 629
//

Text Mined References (3)

PMID Year Title
21269460 2011 Initial characterization of the human central proteome.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
9628581 1998 Prediction of the coding sequences of unidentified human genes. IX. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro.