Property Summary

NCBI Gene PubMed Count 53
Grant Count 107
R01 Count 52
Funding $34,643,684.52
PubMed Score 250.61
PubTator Score 104.68

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
astrocytic glioma 2.000 0.002
ependymoma 1.500 0.016
oligodendroglioma 1.900 0.000
psoriasis -1.400 0.000
osteosarcoma 2.879 0.000
group 4 medulloblastoma 2.000 0.000
atypical teratoid / rhabdoid tumor 1.700 0.000
glioblastoma 1.500 0.013
medulloblastoma, large-cell 2.500 0.000
primitive neuroectodermal tumor 1.100 0.002
ulcerative colitis -1.026 0.001
hereditary spastic paraplegia -1.078 0.016
acute quadriplegic myopathy 1.216 0.000
tuberculosis -1.700 0.000
intraductal papillary-mucinous adenoma (... -1.500 0.000
intraductal papillary-mucinous carcinoma... -1.500 0.001
Pick disease 2.400 0.000
ovarian cancer -2.400 0.000
Gaucher disease type 1 -1.600 0.010
Down syndrome 1.200 0.001
dermatomyositis 1.800 0.002

Synonym

Accession O60271 A6H8U5 A8MSX0 B4DHH2 O60905 Q3KQU8 Q3MKM7 Q86WC7 Q86WC8 Q8IZX7 Q96II0 Q9H811 JIP-4
Symbols JLP
CT89
HLC4
HLC6
JIP4
PHET
PIG6
HLC-6
JIP-4

Gene

PANTHER Protein Class (2)

PDB

2W83  

Gene RIF (31)

PMID Text
27352556 expression of SPAG9 in ECC cells with TGF-beta1 treatment and spheroids formation was increased
26797273 Based on in vitro assays, we found miR-200a-3p significantly inhibit cancer cell proliferation by inducing apoptosis.
26790956 Study suggest that suppression of miR-141 may cause an aberrant overexpression of SPAG9 promoting growth and metastasis of hepatocellular carcinoma cells.
26468278 FOXK1 protein levels and activity are regulated by associating with JLP and PLK1
26293216 SPAG9 overexpression in gastric cancer correlates with poor prognosis and contributes to gastric cancer cell proliferation
26291670 PLK1 binding to JIP4 was found in G2 phase and mitosis, and PLK1 binding was self-primed by PLK1 phosphorylation of JIP4.
25310386 SPAG9 expression is significantly increased in prostate cancer and it may be involved in the process of prostate cancer cell motility, migration and angiogenesis.
25244576 knockdown of Sec8 enhances the binding of JIP4 to MAPK kinase 4, thereby decreasing the phosphorylation of MAPK kinase 4, JNK, and p38.
25033008 SPAG9 was upregulated in nonmelanoma skin cancer when compared with normal skin.
24801907 SPAG9 is overexpressed in human HCC and serves as a prognostic marker. SPAG9 contributes to cancer cell growth through regulation of cyclin proteins.
More...

AA Sequence

MELEDGVVYQEEPGGSGAVMSERVSGLAGSIYREFERLIGRYDEEVVKELMPLVVAVLENLDSVFAQDQE      1 - 70
HQVELELLRDDNEQLITQYEREKALRKHAEEKFIEFEDSQEQEKKDLQTRVESLESQTRQLELKAKNYAD     71 - 140
QISRLEEREAELKKEYNALHQRHTEMIHNYMEHLERTKLHQLSGSDQLESTAHSRIRKERPISLGIFPLP    141 - 210
AGDGLLTPDAQKGGETPGSEQWKFQELSQPRSHTSLKVSNSPEPQKAVEQEDELSDVSQGGSKATTPAST    211 - 280
ANSDVATIPTDTPLKEENEGFVKVTDAPNKSEISKHIEVQVAQETRNVSTGSAENEEKSEVQAIIESTPE    281 - 350
LDMDKDLSGYKGSSTPTKGIENKAFDRNTESLFEELSSAGSGLIGDVDEGADLLGMGREVENLILENTQL    351 - 420
LETKNALNIVKNDLIAKVDELTCEKDVLQGELEAVKQAKLKLEEKNRELEEELRKARAEAEDARQKAKDD    421 - 490
DDSDIPTAQRKRFTRVEMARVLMERNQYKERLMELQEAVRWTEMIRASRENPAMQEKKRSSIWQFFSRLF    491 - 560
SSSSNTTKKPEPPVNLKYNAPTSHVTPSVKKRSSTLSQLPGDKSKAFDFLSEETEASLASRREQKREQYR    561 - 630
QVKAHVQKEDGRVQAFGWSLPQKYKQVTNGQGENKMKNLPVPVYLRPLDEKDTSMKLWCAVGVNLSGGKT    631 - 700
RDGGSVVGASVFYKDVAGLDTEGSKQRSASQSSLDKLDQELKEQQKELKNQEELSSLVWICTSTHSATKV    701 - 770
LIIDAVQPGNILDSFTVCNSHVLCIASVPGARETDYPAGEDLSESGQVDKASLCGSMTSNSSAETDSLLG    771 - 840
GITVVGCSAEGVTGAATSPSTNGASPVMDKPPEMEAENSEVDENVPTAEEATEATEGNAGSAEDTVDISQ    841 - 910
TGVYTEHVFTDPLGVQIPEDLSPVYQSSNDSDAYKDQISVLPNEQDLVREEAQKMSSLLPTMWLGAQNGC    911 - 980
LYVHSSVAQWRKCLHSIKLKDSILSIVHVKGIVLVALADGTLAIFHRGVDGQWDLSNYHLLDLGRPHHSI    981 - 1050
RCMTVVHDKVWCGYRNKIYVVQPKAMKIEKSFDAHPRKESQVRQLAWVGDGVWVSIRLDSTLRLYHAHTY   1051 - 1120
QHLQDVDIEPYVSKMLGTGKLGFSFVRITALMVSCNRLWVGTGNGVIISIPLTETNKTSGVPGNRPGSVI   1121 - 1190
RVYGDENSDKVTPGTFIPYCSMAHAQLCFHGHRDAVKFFVAVPGQVISPQSSSSGTDLTGDKAGPSAQEP   1191 - 1260
GSQTPLKSMLVISGGEGYIDFRMGDEGGESELLGEDLPLEPSVTKAERSHLIVWQVMYGNE            1261 - 1321
//

Text Mined References (65)

PMID Year Title
27352556 2016 SPAG9 promotes endometrial carcinoma cell invasion through regulation of genes related to the epithelial-mesenchymal transition.
26797273 2016 MicroRNA-200a-3p suppresses tumor proliferation and induces apoptosis by targeting SPAG9 in renal cell carcinoma.
26790956 2016 Direct targeting sperm-associated antigen 9 by miR-141 influences hepatocellular carcinoma cell growth and metastasis via JNK pathway.
26468278 2015 JNK-associated Leucine Zipper Protein Functions as a Docking Platform for Polo-like Kinase 1 and Regulation of the Associating Transcription Factor Forkhead Box Protein K1.
26293216 2015 Overexpression of SPAG9 in human gastric cancer is correlated with poor prognosis.
26291670 2015 JIP4 is a PLK1 binding protein that regulates p38MAPK activity in G2 phase.
25609649 2015 Proteomic analyses reveal distinct chromatin-associated and soluble transcription factor complexes.
25310386 2014 SPAG9 expression is increased in human prostate cancer and promotes cell motility, invasion and angiogenesis in vitro.
25244576 2014 Knockdown of Sec8 enhances the binding affinity of c-Jun N-terminal kinase (JNK)-interacting protein 4 for mitogen-activated protein kinase kinase 4 (MKK4) and suppresses the phosphorylation of MKK4, p38, and JNK, thereby inhibiting apoptosis.
25033008 2015 Immunohistochemical expression of sperm-associated antigen 9 in nonmelanoma skin cancer.
More...