Property Summary

NCBI Gene PubMed Count 57
PubMed Score 258.55
PubTator Score 104.68

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
acute quadriplegic myopathy 1.157 4.8e-04
astrocytic glioma 1.300 7.8e-03
atypical teratoid / rhabdoid tumor 1.700 3.2e-04
dermatomyositis 1.800 1.8e-03
Down syndrome 1.100 2.7e-03
ependymoma 1.500 1.6e-02
Gaucher disease type 1 -1.600 9.6e-03
glioblastoma 1.500 1.3e-02
group 4 medulloblastoma 2.000 1.0e-04
hereditary spastic paraplegia -1.078 1.6e-02
intraductal papillary-mucinous adenoma (... -1.200 7.7e-03
intraductal papillary-mucinous carcinoma... -1.500 1.1e-03
medulloblastoma, large-cell 1.100 5.9e-03
oligodendroglioma 1.100 1.3e-02
osteosarcoma 2.547 4.8e-08
ovarian cancer -2.400 1.2e-10
Pick disease 1.500 2.9e-05
primitive neuroectodermal tumor 1.100 1.6e-03
psoriasis -1.300 3.3e-04
tuberculosis -1.500 8.6e-09
ulcerative colitis -1.026 8.4e-04

Gene RIF (33)

AA Sequence

MELEDGVVYQEEPGGSGAVMSERVSGLAGSIYREFERLIGRYDEEVVKELMPLVVAVLENLDSVFAQDQE      1 - 70
HQVELELLRDDNEQLITQYEREKALRKHAEEKFIEFEDSQEQEKKDLQTRVESLESQTRQLELKAKNYAD     71 - 140
QISRLEEREAELKKEYNALHQRHTEMIHNYMEHLERTKLHQLSGSDQLESTAHSRIRKERPISLGIFPLP    141 - 210
AGDGLLTPDAQKGGETPGSEQWKFQELSQPRSHTSLKVSNSPEPQKAVEQEDELSDVSQGGSKATTPAST    211 - 280
ANSDVATIPTDTPLKEENEGFVKVTDAPNKSEISKHIEVQVAQETRNVSTGSAENEEKSEVQAIIESTPE    281 - 350
LDMDKDLSGYKGSSTPTKGIENKAFDRNTESLFEELSSAGSGLIGDVDEGADLLGMGREVENLILENTQL    351 - 420
LETKNALNIVKNDLIAKVDELTCEKDVLQGELEAVKQAKLKLEEKNRELEEELRKARAEAEDARQKAKDD    421 - 490
DDSDIPTAQRKRFTRVEMARVLMERNQYKERLMELQEAVRWTEMIRASRENPAMQEKKRSSIWQFFSRLF    491 - 560
SSSSNTTKKPEPPVNLKYNAPTSHVTPSVKKRSSTLSQLPGDKSKAFDFLSEETEASLASRREQKREQYR    561 - 630
QVKAHVQKEDGRVQAFGWSLPQKYKQVTNGQGENKMKNLPVPVYLRPLDEKDTSMKLWCAVGVNLSGGKT    631 - 700
RDGGSVVGASVFYKDVAGLDTEGSKQRSASQSSLDKLDQELKEQQKELKNQEELSSLVWICTSTHSATKV    701 - 770
LIIDAVQPGNILDSFTVCNSHVLCIASVPGARETDYPAGEDLSESGQVDKASLCGSMTSNSSAETDSLLG    771 - 840
GITVVGCSAEGVTGAATSPSTNGASPVMDKPPEMEAENSEVDENVPTAEEATEATEGNAGSAEDTVDISQ    841 - 910
TGVYTEHVFTDPLGVQIPEDLSPVYQSSNDSDAYKDQISVLPNEQDLVREEAQKMSSLLPTMWLGAQNGC    911 - 980
LYVHSSVAQWRKCLHSIKLKDSILSIVHVKGIVLVALADGTLAIFHRGVDGQWDLSNYHLLDLGRPHHSI    981 - 1050
RCMTVVHDKVWCGYRNKIYVVQPKAMKIEKSFDAHPRKESQVRQLAWVGDGVWVSIRLDSTLRLYHAHTY   1051 - 1120
QHLQDVDIEPYVSKMLGTGKLGFSFVRITALMVSCNRLWVGTGNGVIISIPLTETNKTSGVPGNRPGSVI   1121 - 1190
RVYGDENSDKVTPGTFIPYCSMAHAQLCFHGHRDAVKFFVAVPGQVISPQSSSSGTDLTGDKAGPSAQEP   1191 - 1260
GSQTPLKSMLVISGGEGYIDFRMGDEGGESELLGEDLPLEPSVTKAERSHLIVWQVMYGNE            1261 - 1321
//

Text Mined References (69)

PMID Year Title