Property Summary

NCBI Gene PubMed Count 8
PubMed Score 5.45
PubTator Score 3.29

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count
Bipolar Disorder 666
Disease Target Count P-value
diabetes mellitus 1728 1.0e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Pulmonary sclerosing hemangioma 8 3.726 1.9

Expression

  Differential Expression (1)

Disease log2 FC p
diabetes mellitus 1.400 1.0e-03

AA Sequence

MSSSRPEPGPWAPLSPRLQPLSQSSSSLLGEGREQRPELRKTASSTVWQAQLGEASTRPQAPEEEGNPPE      1 - 70
SMKPARASGPKARPSAGGHWWSSTVGNVSTMGGSDLCRLRAPSAAAMQRSHSDLVRSTQMRGHSGARKAS     71 - 140
LSCSALGSSPVHRAQLQPGGTSGQGGQAPAGLERDLAPEDETSNSAWMLGASQLSVPPLDLGDTTAHSSS    141 - 210
AQAEPKAAEQLATTTCHALPPAALLCGMREVRAGGCCHALPATGILAFPKLVASVSESGLQAQHGVKIHC    211 - 280
RLSGGLPGHSHCCAHLWGPAGLVPEPGSRTKDVWTMTSANDLAPAEASPLSAQDAGVQAAPVAACKAVAT    281 - 350
SPSLEAPAALHVFPEVTLGSSLEEVPSPVRDVRWDAEGMTWEVYGAAVDLEVLGVAIQKHLEMQFEQLQR    351 - 420
APASEDSLSVEGRRGPLRAVMQSLRRPSCCGCSGAAPE                                    421 - 458
//

Text Mined References (8)

PMID Year Title