Property Summary

NCBI Gene PubMed Count 9
Grant Count 1
Funding $295,904.7
PubMed Score 1.19
PubTator Score 0.75

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
malignant mesothelioma -1.800 0.000
astrocytoma -2.000 0.000
ependymoma -2.800 0.000
oligodendroglioma -2.100 0.000
glioblastoma -2.900 0.000
osteosarcoma -2.009 0.000
sonic hedgehog group medulloblastoma -2.800 0.000
atypical teratoid / rhabdoid tumor -3.500 0.000
medulloblastoma, large-cell -3.400 0.000
primitive neuroectodermal tumor -2.600 0.000
colon cancer -1.300 0.007
lung cancer -1.900 0.000
pediatric high grade glioma -2.700 0.000
pilocytic astrocytoma -2.200 0.000
subependymal giant cell astrocytoma -2.162 0.037
Pick disease -1.400 0.011
mucosa-associated lymphoid tissue lympho... 1.564 0.006
pituitary cancer -1.800 0.000

Gene RIF (2)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
17010949 KIAA0513 is likely to be involved in signaling pathways related to neuroplasticity, apoptosis, and cytoskeletal regulation and is upregulated in the prefrontal cortex in schizophrenia.

AA Sequence

METPEVPVGSLIDFGPEAPTSSPLEAPPPVLQDGDGSLGDGASESETTESADSENDMGESPSHPSWDQDR      1 - 70
RSSSNESFSSNQSTESTQDEETLALRDFMRGYVEKIFSGGEDLDQEEKAKFGEYCSSENGKGREWFARYV     71 - 140
SAQRCNSKCVSEATFYRLVQSFAVVLFECHQMDDFGPAKNLMTMCFTYYHIGKPQLLPPESREKPAGSID    141 - 210
SYLKSANSWLAEKKDIAERLLKNTSARTENVKGFFGGLETKLKGPLARRNEEDENKPQEKRPRAVTAYSP    211 - 280
EDEKKGEKIYLYTHLKQQPIWHTLRFWNAAFFDAVHCERTKRSPTTRGDAGEEEEKREKWCHMTQEERDD    281 - 350
SLRFNENITFGQLGTFTHNMLAFGLNKKLCNDFLKKQAVIGNLDEEQYKLLSDHIEQMATE             351 - 411
//

Text Mined References (12)

PMID Year Title
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22959728 2013 Age of onset of amyotrophic lateral sclerosis is modulated by a locus on 1p34.1.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17010949 2006 Characterization of KIAA0513, a novel signaling molecule that interacts with modulators of neuroplasticity, apoptosis, and the cytoskeleton.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9628581 1998 Prediction of the coding sequences of unidentified human genes. IX. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro.
More...