Property Summary

NCBI Gene PubMed Count 49
Grant Count 65
R01 Count 44
Funding $9,150,628.72
PubMed Score 182.70
PubTator Score 68.97

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
osteosarcoma -1.134 0.042
atypical teratoid / rhabdoid tumor -1.200 0.000
medulloblastoma, large-cell -1.100 0.000
colon cancer 3.200 0.040
adult high grade glioma -1.100 0.000
group 4 medulloblastoma -1.100 0.000
gastric carcinoma 1.500 0.011

Synonym

Accession O60266 B3KT86 Q53T54 Q9UDB1
Symbols AC3
AC-III

Gene

PANTHER Protein Class (3)

Gene RIF (22)

PMID Text
25431134 Similar results were obtained after sustained stimulation with NKH477 to directly activate adenylyl cyclase
25044758 The association signal of height-adjusted BMI at ADCY3 appeared to be driven by a missense variant and it was strongly correlated with expression of this gene.
24113161 Data demonstrate that the expression of ADCY3 is regulated through an epigenetic mechanism.
23077041 Genetically mutated serine(1076) of adenylyl cyclase III (ACIII) affects neither the cilial localization nor expression level of ACIII in olfactory sensory neurons.
22681560 endoplasmic reticulum calcium store operated cAMP production occurred preferentially via the adenylate cyclase 3
21079816 Data show that AC3 genetic polymorphisms are associated with decreased risk of obesity among adults but not in children in a Chinese Han population.
21079816 Observational study of gene-disease association. (HuGE Navigator)
21042317 This study suggested that the adenylate cyclase 3 (ADCY3, 2p23.3) related to major depressive disorder.
21042317 Observational study, meta-analysis, and genome-wide association study of gene-disease association. (HuGE Navigator)
20201924 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MPRNQGFSEPEYSAEYSAEYSVSLPSDPDRGVGRTHEISVRNSGSCLCLPRFMRLTFVPESLENLYQTYF      1 - 70
KRQRHETLLVLVVFAALFDCYVVVMCAVVFSSDKLASLAVAGIGLVLDIILFVLCKKGLLPDRVTRRVLP     71 - 140
YVLWLLITAQIFSYLGLNFARAHAASDTVGWQVFFVFSFFITLPLSLSPIVIISVVSCVVHTLVLGVTVA    141 - 210
QQQQEELKGMQLLREILANVFLYLCAIAVGIMSYYMADRKHRKAFLEARQSLEVKMNLEEQSQQQENLML    211 - 280
SILPKHVADEMLKDMKKDESQKDQQQFNTMYMYRHENVSILFADIVGFTQLSSACSAQELVKLLNELFAR    281 - 350
FDKLAAKYHQLRIKILGDCYYCICGLPDYREDHAVCSILMGLAMVEAISYVREKTKTGVDMRVGVHTGTV    351 - 420
LGGVLGQKRWQYDVWSTDVTVANKMEAGGIPGRVHISQSTMDCLKGEFDVEPGDGGSRCDYLEEKGIETY    421 - 490
LIIASKPEVKKTATQNGLNGSALPNGAPASSKSSSPALIETKEPNGSAHSSGSTSEKPEEQDAQADNPSF    491 - 560
PNPRRRLRLQDLADRVVDASEDEHELNQLLNEALLERESAQVVKKRNTFLLSMRFMDPEMETRYSVEKEK    561 - 630
QSGAAFSCSCVVLLCTALVEILIDPWLMTNYVTFMVGEILLLILTICSLAAIFPRAFPKKLVAFSTWIDR    631 - 700
TRWARNTWAMLAIFILVMANVVDMLSCLQYYTGPSNATAGMETEGSCLENPKYYNYVAVLSLIATIMLVQ    701 - 770
VSHMVKLTLMLLVAGAVATINLYAWRPVFDEYDHKRFREHDLPMVALEQMQGFNPGLNGTDRLPLVPSKY    771 - 840
SMTVMVFLMMLSFYYFSRHVEKLARTLFLWKIEVHDQKERVYEMRRWNEALVTNMLPEHVARHFLGSKKR    841 - 910
DEELYSQTYDEIGVMFASLPNFADFYTEESINNGGIECLRFLNEIISDFDSLLDNPKFRVITKIKTIGST    911 - 980
YMAASGVTPDVNTNGFASSNKEDKSERERWQHLADLADFALAMKDTLTNINNQSFNNFMLRIGMNKGGVL    981 - 1050
AGVIGARKPHYDIWGNTVNVASRMESTGVMGNIQVVEETQVILREYGFRFVRRGPIFVKGKGELLTFFLK   1051 - 1120
GRDKLATFPNGPSVTLPHQVVDNS                                                 1121 - 1144
//

Text Mined References (51)

PMID Year Title
25431134 2015 Sustained signalling by PTH modulates IP3 accumulation and IP3 receptors through cyclic AMP junctions.
25044758 2014 Genome-wide association study of height-adjusted BMI in childhood identifies functional variant in ADCY3.
24861553 2014 Meta-analysis of genome-wide association studies in East Asian-ancestry populations identifies four new loci for body mass index.
24113161 2013 Upregulation of adenylate cyclase 3 (ADCY3) increases the tumorigenic potential of cells by activating the CREB pathway.
23583978 2013 A meta-analysis identifies new loci associated with body mass index in individuals of African ancestry.
23563607 2013 Genome-wide meta-analysis identifies 11 new loci for anthropometric traits and provides insights into genetic architecture.
23517042 2013 Genome-wide association study of body mass index in 23 000 individuals with and without asthma.
23449627 2013 Genome-wide association and longitudinal analyses reveal genetic loci linking pubertal height growth, pubertal timing and childhood adiposity.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
More...