Property Summary

NCBI Gene PubMed Count 62
PubMed Score 128.43
PubTator Score 68.75

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
active Crohn's disease 1.151 9.0e-03
Amyotrophic lateral sclerosis 1.013 2.6e-06
cutaneous lupus erythematosus 1.300 1.4e-03
invasive ductal carcinoma 1.100 1.3e-03
lung adenocarcinoma -1.300 2.5e-21
medulloblastoma 1.100 1.5e-07
medulloblastoma, large-cell 1.200 6.4e-06
Multiple myeloma 1.337 2.8e-04
osteosarcoma -1.324 1.0e-04
ovarian cancer 1.500 3.2e-04
pediatric high grade glioma 1.100 1.0e-05
primitive neuroectodermal tumor 1.100 2.1e-04
psoriasis -1.400 1.8e-04
tuberculosis and treatment for 3 months -1.100 1.2e-05
Waldenstrons macroglobulinemia 1.138 1.0e-02

Protein-protein Interaction (3)

Gene RIF (32)

AA Sequence

MSSAAEPPPPPPPESAPSKPAASIASGGSNSSNKGGPEGVAAQAVASAASAGPADAEMEEIFDDASPGKQ      1 - 70
KEIQEPDPTYEEKMQTDRANRFEYLLKQTELFAHFIQPAAQKTPTSPLKMKPGRPRIKKDEKQNLLSVGD     71 - 140
YRHRRTEQEEDEELLTESSKATNVCTRFEDSPSYVKWGKLRDYQVRGLNWLISLYENGINGILADEMGLG    141 - 210
KTLQTISLLGYMKHYRNIPGPHMVLVPKSTLHNWMSEFKRWVPTLRSVCLIGDKEQRAAFVRDVLLPGEW    211 - 280
DVCVTSYEMLIKEKSVFKKFNWRYLVIDEAHRIKNEKSKLSEIVREFKTTNRLLLTGTPLQNNLHELWSL    281 - 350
LNFLLPDVFNSADDFDSWFDTNNCLGDQKLVERLHMVLRPFLLRRIKADVEKSLPPKKEVKIYVGLSKMQ    351 - 420
REWYTRILMKDIDILNSAGKMDKMRLLNILMQLRKCCNHPYLFDGAEPGPPYTTDMHLVTNSGKMVVLDK    421 - 490
LLPKLKEQGSRVLIFSQMTRVLDILEDYCMWRNYEYCRLDGQTPHDERQDSINAYNEPNSTKFVFMLSTR    491 - 560
AGGLGINLATADVVILYDSDWNPQVDLQAMDRAHRIGQTKTVRVFRFITDNTVEERIVERAEMKLRLDSI    561 - 630
VIQQGRLVDQNLNKIGKDEMLQMIRHGATHVFASKESEITDEDIDGILERGAKKTAEMNEKLSKMGESSL    631 - 700
RNFTMDTESSVYNFEGEDYREKQKIAFTEWIEPPKRERKANYAVDAYFREALRVSEPKAPKAPRPPKQPN    701 - 770
VQDFQFFPPRLFELLEKEILFYRKTIGYKVPRNPELPNAAQAQKEEQLKIDEAESLNDEELEEKEKLLTQ    771 - 840
GFTNWNKRDFNQFIKANEKWGRDDIENIAREVEGKTPEEVIEYSAVFWERCNELQDIEKIMAQIERGEAR    841 - 910
IQRRISIKKALDTKIGRYKAPFHQLRISYGTNKGKNYTEEEDRFLICMLHKLGFDKENVYDELRQCIRNS    911 - 980
PQFRFDWFLKSRTAMELQRRCNTLITLIERENMELEEKEKAEKKKRGPKPSTQKRKMDGAPDGRGRKKKL    981 - 1050
KL                                                                       1051 - 1052
//

Text Mined References (74)

PMID Year Title