Property Summary

NCBI Gene PubMed Count 60
Grant Count 42
R01 Count 24
Funding $2,622,448.7
PubMed Score 120.58
PubTator Score 68.75

Knowledge Summary

Patent

No data available

Expression

Gene RIF (30)

PMID Text
27019336 The action of SNF2H at CTCF sites is functionally important as depletion of CTCF or SNF2H affects transcription of a common group of genes.
25684208 Data show the mechanism of nucleosome sliding by the chromatin remodeling motor SNF2h protein.
25533843 CHD3.1 and ACF1-SNF2H display counteractive activities but similar histone affinities.
25377162 Knockdown of SMARCA5 expression in MDA-MB-231 and MDA-MB-435s cell lines.
24990377 SMARCA5 targeting to UV-C damage depends on transcription and histone modifications and requires functional SWI2/SNF2-ATPase and SLIDE domains.
24607692 this study finds that the H4 tail promotes ATP-binding pocket closure in SNF2h.
24498324 Data show that CCCTC-binding factor (CTCF) together with ISWI ATPase SMARCA5 and members of the Cohesin complex associate with the SPI1 protein is disrupted in acute myeloid leukemia (AML) blasts.
23319141 Data indicate that the heterochromatic H2A.X is preferentially phosphorylated presumably by the accumulating WSTF-ISWI chromatin remodeling (WICH) complex, and suggests that Tyr142p might have a specific role in heterochromatin.
23264744 study unveils a functional link between DNA damage-induced poly(ADP-ribosyl)ation, SMARCA5-mediated chromatin remodeling and RNF168-dependent signaling and repair of DSBs.
22525276 Introduction of the miR-99 family of miRNAs into cells reduced the rate and overall efficiency of repair by both homologous recombination and non-homologous end joining.
More...

AA Sequence

MSSAAEPPPPPPPESAPSKPAASIASGGSNSSNKGGPEGVAAQAVASAASAGPADAEMEEIFDDASPGKQ      1 - 70
KEIQEPDPTYEEKMQTDRANRFEYLLKQTELFAHFIQPAAQKTPTSPLKMKPGRPRIKKDEKQNLLSVGD     71 - 140
YRHRRTEQEEDEELLTESSKATNVCTRFEDSPSYVKWGKLRDYQVRGLNWLISLYENGINGILADEMGLG    141 - 210
KTLQTISLLGYMKHYRNIPGPHMVLVPKSTLHNWMSEFKRWVPTLRSVCLIGDKEQRAAFVRDVLLPGEW    211 - 280
DVCVTSYEMLIKEKSVFKKFNWRYLVIDEAHRIKNEKSKLSEIVREFKTTNRLLLTGTPLQNNLHELWSL    281 - 350
LNFLLPDVFNSADDFDSWFDTNNCLGDQKLVERLHMVLRPFLLRRIKADVEKSLPPKKEVKIYVGLSKMQ    351 - 420
REWYTRILMKDIDILNSAGKMDKMRLLNILMQLRKCCNHPYLFDGAEPGPPYTTDMHLVTNSGKMVVLDK    421 - 490
LLPKLKEQGSRVLIFSQMTRVLDILEDYCMWRNYEYCRLDGQTPHDERQDSINAYNEPNSTKFVFMLSTR    491 - 560
AGGLGINLATADVVILYDSDWNPQVDLQAMDRAHRIGQTKTVRVFRFITDNTVEERIVERAEMKLRLDSI    561 - 630
VIQQGRLVDQNLNKIGKDEMLQMIRHGATHVFASKESEITDEDIDGILERGAKKTAEMNEKLSKMGESSL    631 - 700
RNFTMDTESSVYNFEGEDYREKQKIAFTEWIEPPKRERKANYAVDAYFREALRVSEPKAPKAPRPPKQPN    701 - 770
VQDFQFFPPRLFELLEKEILFYRKTIGYKVPRNPELPNAAQAQKEEQLKIDEAESLNDEELEEKEKLLTQ    771 - 840
GFTNWNKRDFNQFIKANEKWGRDDIENIAREVEGKTPEEVIEYSAVFWERCNELQDIEKIMAQIERGEAR    841 - 910
IQRRISIKKALDTKIGRYKAPFHQLRISYGTNKGKNYTEEEDRFLICMLHKLGFDKENVYDELRQCIRNS    911 - 980
PQFRFDWFLKSRTAMELQRRCNTLITLIERENMELEEKEKAEKKKRGPKPSTQKRKMDGAPDGRGRKKKL    981 - 1050
KL                                                                       1051 - 1052
//

Text Mined References (71)

PMID Year Title
27019336 2016 The Chromatin Remodelling Enzymes SNF2H and SNF2L Position Nucleosomes adjacent to CTCF and Other Transcription Factors.
26100909 2015 BEND3 represses rDNA transcription by stabilizing a NoRC component via USP21 deubiquitinase.
25684208 2015 A nucleotide-driven switch regulates flanking DNA length sensing by a dimeric chromatin remodeler.
25533843 2014 Opposing ISWI- and CHD-class chromatin remodeling activities orchestrate heterochromatic DNA repair.
25377162 2015 Overexpression of SMARCA5 correlates with cell proliferation and migration in breast cancer.
24990377 2014 Human ISWI complexes are targeted by SMARCA5 ATPase and SLIDE domains to help resolve lesion-stalled transcription.
24607692 2014 The histone H4 tail regulates the conformation of the ATP-binding pocket in the SNF2h chromatin remodeling enzyme.
24498324 2014 Epigenetic control of SPI1 gene by CTCF and ISWI ATPase SMARCA5.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23319141 2013 The proteomic investigation of chromatin functional domains reveals novel synergisms among distinct heterochromatin components.
More...