Property Summary

NCBI Gene PubMed Count 19
PubMed Score 5.38
PubTator Score 5.12

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
adult high grade glioma -1.300 2.0e-04
astrocytic glioma -1.100 2.9e-02
atypical teratoid / rhabdoid tumor -1.800 8.7e-06
Breast cancer -1.900 9.4e-31
breast carcinoma -1.100 1.0e-05
ependymoma -1.700 9.1e-10
glioblastoma -1.200 2.3e-04
group 3 medulloblastoma -1.600 3.2e-04
interstitial cystitis 1.100 2.9e-02
intraductal papillary-mucinous carcinoma... -1.500 2.0e-03
intraductal papillary-mucinous neoplasm ... -1.200 1.3e-02
invasive ductal carcinoma -1.100 2.5e-02
lung cancer -1.100 3.8e-02
medulloblastoma, large-cell -2.100 2.0e-06
non primary Sjogren syndrome sicca 1.200 2.7e-02
non-small cell lung cancer -1.202 9.1e-15
osteosarcoma -1.226 1.1e-04
periodontitis 1.100 7.2e-21
primitive neuroectodermal tumor -1.200 1.4e-02
psoriasis -1.100 8.3e-41

Gene RIF (5)

AA Sequence

MSATNNIAQARKLVEQLRIEAGIERIKVSKAASDLMSYCEQHARNDPLLVGVPASENPFKDKKPCIIL        1 - 68
//

Text Mined References (21)

PMID Year Title