Property Summary

NCBI Gene PubMed Count 19
PubMed Score 5.38
PubTator Score 5.12

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Esophageal Neoplasms 67
Disease Target Count P-value
psoriasis 6685 8.25062612327902E-41
periodontitis 269 7.24697881829094E-21
non-small cell lung cancer 2798 9.05647283353047E-15
ependymoma 2514 9.08647601716551E-10
non-inflammatory breast cancer 208 4.32885058312372E-8
pediatric high grade glioma 2712 1.40264237900482E-6
medulloblastoma, large-cell 6234 6.19051679829214E-6
atypical teratoid / rhabdoid tumor 4369 8.67705650937713E-6
breast carcinoma 1614 1.0236638935651E-5
group 3 medulloblastoma 2254 2.05017359640293E-5
glioblastoma 5572 1.59960817440163E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00201994407299314
primitive neuroectodermal tumor 3031 0.00291345576365776
osteosarcoma 7933 0.00611193903128758
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0131262844802739
invasive ductal carcinoma 2950 0.0248580945611415
non primary Sjogren syndrome sicca 840 0.0265886475335361
astrocytic glioma 2241 0.0288747023691105
interstitial cystitis 2299 0.0291312427501145
lung cancer 4473 0.0376286227234936
Disease Target Count Z-score Confidence
Bloom syndrome 30 3.307 1.7
Gilles de la Tourette syndrome 47 3.168 1.6

Expression

Synonym

Accession O60262 B2R496
Symbols

Gene

  Ortholog (10)

Gene RIF (5)

PMID Text
23403885 GNG7 is a highly specific promoter methylated gene associated with head and neck cancer.
22183866 Loss of GNG7 protein expression is a frequent event in head and neck cancer with hypermethylation of the promoter region of GNG7 being probably the mechanism for the observed inactivation.
20543539 Reduced expression of G-gamma 7 is associated with the histological grade of EHCC and may prove to be a useful marker for predicting the prognosis of human EHCC.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18219292 GNG7 suppression represents a new prognostic indicator in cases of oesophageal cancer.

AA Sequence

MSATNNIAQARKLVEQLRIEAGIERIKVSKAASDLMSYCEQHARNDPLLVGVPASENPFKDKKPCIIL        1 - 68
//

Text Mined References (21)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24324551 2013 Genome wide association study (GWAS) of Chagas cardiomyopathy in Trypanosoma cruzi seropositive subjects.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23403885 2013 Identification of guanine nucleotide-binding protein ?-7 as an epigenetically silenced gene in head and neck cancer by gene expression profiling.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22183866 2012 Loss of protein expression and recurrent DNA hypermethylation of the GNG7 gene in squamous cell carcinoma of the head and neck.
20543539 2010 Human G-protein gamma 7 in extrahepatic cholangiocarcinoma and its clinicopathological significance.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
More...