Property Summary

NCBI Gene PubMed Count 19
Grant Count 8
R01 Count 6
Funding $1,599,063
PubMed Score 5.38
PubTator Score 5.12

Knowledge Summary

Patent

No data available

Expression

Gene RIF (5)

PMID Text
23403885 GNG7 is a highly specific promoter methylated gene associated with head and neck cancer.
22183866 Loss of GNG7 protein expression is a frequent event in head and neck cancer with hypermethylation of the promoter region of GNG7 being probably the mechanism for the observed inactivation.
20543539 Reduced expression of G-gamma 7 is associated with the histological grade of EHCC and may prove to be a useful marker for predicting the prognosis of human EHCC.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18219292 GNG7 suppression represents a new prognostic indicator in cases of oesophageal cancer.

AA Sequence

MSATNNIAQARKLVEQLRIEAGIERIKVSKAASDLMSYCEQHARNDPLLVGVPASENPFKDKKPCIIL        1 - 68
//

Text Mined References (21)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24324551 2013 Genome wide association study (GWAS) of Chagas cardiomyopathy in Trypanosoma cruzi seropositive subjects.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23403885 2013 Identification of guanine nucleotide-binding protein ?-7 as an epigenetically silenced gene in head and neck cancer by gene expression profiling.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22183866 2012 Loss of protein expression and recurrent DNA hypermethylation of the GNG7 gene in squamous cell carcinoma of the head and neck.
20543539 2010 Human G-protein gamma 7 in extrahepatic cholangiocarcinoma and its clinicopathological significance.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
More...