Property Summary

Ligand Count 4
NCBI Gene PubMed Count 40
PubMed Score 226.17
PubTator Score 79.77

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count
Bipolar Disorder 666
Schizophrenia 1160
Disease Target Count P-value
psoriasis 6694 5.3e-27
cystic fibrosis 1696 5.9e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7

Expression

  Differential Expression (2)

Disease log2 FC p
cystic fibrosis 1.800 5.9e-04
psoriasis 1.200 5.3e-27

Gene RIF (19)

AA Sequence

MGRPRPRAAKTWMFLLLLGGAWAGHSRAQEDKVLGGHECQPHSQPWQAALFQGQQLLCGGVLVGGNWVLT      1 - 70
AAHCKKPKYTVRLGDHSLQNKDGPEQEIPVVQSIPHPCYNSSDVEDHNHDLMLLQLRDQASLGSKVKPIS     71 - 140
LADHCTQPGQKCTVSGWGTVTSPRENFPDTLNCAEVKIFPQKKCEDAYPGQITDGMVCAGSSKGADTCQG    141 - 210
DSGGPLVCDGALQGITSWGSDPCGRSDKPGVYTNICRYLDWIKKIIGSKG                        211 - 260
//

Text Mined References (44)

PMID Year Title