Property Summary

NCBI Gene PubMed Count 37
Grant Count 23
R01 Count 17
Funding $2,205,763.13
PubMed Score 206.68
PubTator Score 79.77

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
cystic fibrosis 1.800 0.001
psoriasis 1.600 0.000

Gene RIF (17)

PMID Text
26099606 KLK8 mRNA expression is associated with aggressive tumor characteristics and it can serve as a novel independent biomarker of unfavorable prognosis for BC patients.
25926655 Occurring independently of cyclophilins and of furin that mediate human papillomavirus 16 L2 exposure, KLK8-mediated cleavage of L1 likely facilitated access to L2, located in the capsid lumen, and potentially uncoating.
24614639 It dissects a schizophrenic susceptibility gene, NRG1.
22505524 KLK8 and KLK14 can signal differentially via the PARs to affect tissue function
20940292 KLK8 as a new active serine protease in human stratum corneum and sweat
20614312 The results of this study indicate that most salivary gland tumors show high levels of expression of KLK8.
20424135 Observational study of gene-disease association. (HuGE Navigator)
20360129 The KLK8-T4 alternative splice variant, alone or in combination, may be a new independent marker of unfavorable prognosis in lung cancer.
19558318 Combination of KLK2, 3, 13, and 14 and KLK1, 2, 5, 6, 7, 8, 10, 13, and 14 showed very strong discriminatory potential for semen liquefaction and viscosity, respectively.
19125171 The processed end-point enzymes are the same for both type I and type II kallikrein 8, suggesting that the emergence of type II kallikrein 8 in the human brain likely leads to functional modifications of kallikrein 8.
More...

AA Sequence

MGRPRPRAAKTWMFLLLLGGAWAGHSRAQEDKVLGGHECQPHSQPWQAALFQGQQLLCGGVLVGGNWVLT      1 - 70
AAHCKKPKYTVRLGDHSLQNKDGPEQEIPVVQSIPHPCYNSSDVEDHNHDLMLLQLRDQASLGSKVKPIS     71 - 140
LADHCTQPGQKCTVSGWGTVTSPRENFPDTLNCAEVKIFPQKKCEDAYPGQITDGMVCAGSSKGADTCQG    141 - 210
DSGGPLVCDGALQGITSWGSDPCGRSDKPGVYTNICRYLDWIKKIIGSKG                        211 - 260
//

Text Mined References (41)

PMID Year Title
26099606 2015 Clinical relevance of the deregulated kallikrein-related peptidase 8 mRNA expression in breast cancer: a novel independent indicator of disease-free survival.
25926655 2015 Kallikrein-8 Proteolytically Processes Human Papillomaviruses in the Extracellular Space To Facilitate Entry into Host Cells.
25416956 2014 A proteome-scale map of the human interactome network.
24705354 2014 The palmitoyl acyltransferase HIP14 shares a high proportion of interactors with huntingtin: implications for a role in the pathogenesis of Huntington's disease.
24614639 2014 [Neuropsin signaling as a novel therapeutic target of schizophrenia].
22505524 2012 Proteinase-activated receptors (PARs): differential signalling by kallikrein-related peptidases KLK8 and KLK14.
20940292 2011 Kallikrein-related peptidase-8 (KLK8) is an active serine protease in human epidermis and sweat and is involved in a skin barrier proteolytic cascade.
20614312 2008 Human kallikrein 8 expression in salivary gland tumors.
20424135 2010 Blood biomarker levels to aid discovery of cancer-related single-nucleotide polymorphisms: kallikreins and prostate cancer.
20360129 2010 Alternative splicing variant of kallikrein-related peptidase 8 as an independent predictor of unfavorable prognosis in lung cancer.
More...