Property Summary

NCBI Gene PubMed Count 24
Grant Count 24
R01 Count 20
Funding $1,374,530.63
PubMed Score 35.17
PubTator Score 10.97

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -2.000 0.000

Gene RIF (4)

PMID Text
23643382 FGF17 and IL17RD prpopsed as the two top candidates in the entire proteome on the basis of a statistical test of their protein-protein interaction patterns to proteins known to be altered in congenital hypogonadotropic hypogonadism.
21319186 FGF8, FGF17, and FGF18 are involved in autocrine and paracrine signaling in HCC and enhance the survival of tumor cells under stress conditions, malignant behavior, and neoangiogenesis.
21048031 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15129425 FGF17 expression is increased 2-fold in benign prostatic hyperplasia and may contribute to the increased epithelial proliferation seen in this disease.

AA Sequence

MGAARLLPNLTLCLQLLILCCQTQGENHPSPNFNQYVRDQGAMTDQLSRRQIREYQLYSRTSGKHVQVTG      1 - 70
RRISATAEDGNKFAKLIVETDTFGSRVRIKGAESEKYICMNKRGKLIGKPSGKSKDCVFTEIVLENNYTA     71 - 140
FQNARHEGWFMAFTRQGRPRQASRSRQNQREAHFIKRLYQGQLPFPNHAEKQKQFEFVGSAPTRRTKRTR    141 - 210
RPQPLT                                                                    211 - 216
//

Text Mined References (25)

PMID Year Title
23643382 2013 Mutations in FGF17, IL17RD, DUSP6, SPRY4, and FLRT3 are identified in individuals with congenital hypogonadotropic hypogonadism.
21484435 2011 FGF17, a gene involved in cerebellar development, is downregulated in a patient with Dandy-Walker malformation carrying a de novo 8p deletion.
21319186 2011 Up-regulation of the fibroblast growth factor 8 subfamily in human hepatocellular carcinoma for cell survival and neoangiogenesis.
21048031 2011 Single nucleotide polymorphisms of matrix metalloproteinase 9 (MMP9) and tumor protein 73 (TP73) interact with Epstein-Barr virus in chronic lymphocytic leukemia: results from the European case-control study EpiLymph.
20094046 2010 Fibroblast growth factor signalling: from development to cancer.
19122663 2009 Loss-of-function mutations of an inhibitory upstream ORF in the human hairless transcript cause Marie Unna hereditary hypotrichosis.
17133345 2007 Differential signal transduction of alternatively spliced FGFR2 variants expressed in human mammary epithelial cells.
16597617 2006 Receptor specificity of the fibroblast growth factor family. The complete mammalian FGF family.
16384934 2006 Structural basis by which alternative splicing modulates the organizer activity of FGF8 in the brain.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...