Property Summary

NCBI Gene PubMed Count 8
PubMed Score 6.28
PubTator Score 4.89

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
ovarian cancer 8520 6.2e-04
group 3 medulloblastoma 4104 8.9e-03
acute myeloid leukemia 783 3.4e-02
Disease Target Count Z-score Confidence
pancreatic cancer 2398 0.0 0.8
Disease Target Count Z-score Confidence
Retinitis pigmentosa 4 38 3.727 1.9
Hyperuricemia 47 3.519 1.8

Expression

  Differential Expression (3)

Disease log2 FC p
acute myeloid leukemia -1.800 3.4e-02
group 3 medulloblastoma 1.100 8.9e-03
ovarian cancer 1.400 6.2e-04

AA Sequence

MFCVTPPELETKMNITKGGLVLFSANSNSSCMELSKKIAERLGVEMGKVQVYQEPNRETRVQIQESVRGK      1 - 70
DVFIIQTVSKDVNTTIMELLIMVYACKTSCAKSIIGVIPYFPYSKQCKMRKRGSIVSKLLASMMCKAGLT     71 - 140
HLITMDLHQKEIQGFFNIPVDNLRASPFLLQYIQEEIPDYRNAVIVAKSPASAKRAQSFAERLRLGIAVI    141 - 210
HGEAQDAESDLVDGRHSPPMVRSVAAIHPSLEIPMLIPKEKPPITVVGDVGGRIAIIVDDIIDDVDSFLA    211 - 280
AAETLKERGAYKIFVMATHGLLSSDAPRRIEESAIDEVVVTNTIPHEVQKLQCPKIKTVDISMILSEAIR    281 - 350
RIHNGESMSYLFRNIGLDD                                                       351 - 369
//

Text Mined References (18)

PMID Year Title